KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334766
Entry
4334766           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 8B
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4334766
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4334766
   03400 DNA repair and recombination proteins [BR:osa03400]
    4334766
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4334766
  RNA polymerase III system
   RNA polymerase III
     4334766
  RNA polymerase I system
   RNA polymerase I
     4334766
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4334766
SSDB
Motif
Pfam: RNA_pol_Rpb8
Other DBs
NCBI-GeneID: 4334766
NCBI-ProteinID: XP_015633016
UniProt: Q75LB1 Q84SP5
LinkDB
Position
3:complement(35562850..35565291)
AA seq 148 aa
MAEFLFEDIFTVTRLDPDGKKFDRVSRIEARSDQFDMYMQLDVATDVYPMHPGDRFTMVL
VPTLNLDGTPDSAFFTQAGRKTLADKYEYVMHGKLYKISEDKDTSDQNAKKVEMYASFGG
LLVMLKGDPSSAANFELDQRLFLLMRKV
NT seq 447 nt   +upstreamnt  +downstreamnt
atggccgagtttctcttcgaggacatcttcactgtcaccaggctcgaccctgatggcaag
aagtttgacagagtttctcgtatcgaagctcgcagtgaccagttcgatatgtacatgcag
ttagatgttgccacagatgtctatcctatgcatccaggtgacagatttaccatggtcttg
gttcctactttgaacttagatggtaccccagatagcgccttctttacacaggctggcagg
aaaactctggctgacaaatatgagtatgtcatgcatgggaagctttataagatctcagaa
gacaaagacacctctgatcaaaatgctaaaaaagtggagatgtatgcatcatttggtggc
ctcctagtgatgcttaagggtgatccctccagtgctgcgaattttgagctggaccagagg
ctgttcctacttatgcgcaaggtgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341946
Entry
4341946           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 8B
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4341946
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4341946
   03400 DNA repair and recombination proteins [BR:osa03400]
    4341946
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     4341946
  RNA polymerase III system
   RNA polymerase III
     4341946
  RNA polymerase I system
   RNA polymerase I
     4341946
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4341946
SSDB
Motif
Pfam: RNA_pol_Rpb8 PRIMA1
Other DBs
NCBI-GeneID: 4341946
NCBI-ProteinID: XP_015644253
UniProt: A3BF08
LinkDB
Position
6:complement(29173197..29175636)
AA seq 191 aa
MWAPLLPPLSATYTRTQPCKNPCQFSQPTPAFPSRPLTPPPPPRKMVEHLFEDIFTVTRL
DPDGKKFDRVSRIEARSEQFDMYMQLDVATEVYPMRAGDRFTMVLAPTLNLDGTPDTGFY
TQAGRKTLADKFDYVMHGKLYKISEDSSSGQATKVEIYASFGGLLMMLKGDPSSAASFEL
DQRLFLLIRKV
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtgggccccactcctcccccctctttccgccacatacacaagaacccaaccatgtaaa
aacccttgccaattttcgcagccaactccggctttcccctcgcgacctctcacgccgccg
ccgccgccgaggaaaatggttgagcacctattcgaggatatcttcactgtgaccaggctc
gatcctgatgggaagaagttcgacagagttagtcgcatcgaagctcgtagcgagcagttc
gacatgtacatgcagttagatgttgctactgaggtctatccgatgcgtgctggtgacaga
ttcaccatggttttagctcctactctgaatctggatggaactccggacactggcttctac
acgcaggctggcagaaaaacacttgctgacaagtttgactatgtcatgcatggaaagctc
tacaagatctcagaagacagttccagtggtcaagccaccaaagtggagatctatgcatcg
tttggtggccttctgatgatgctcaagggtgacccctccagtgccgctagctttgagctg
gaccagaggctgttcctcctcattcgaaaggtgtag

DBGET integrated database retrieval system