KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334782
Entry
4334782           CDS       T01015                                 
Name
(RefSeq) RPM1-interacting protein 4
  KO
K13456  RPM1-interacting protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4334782
SSDB
Motif
Pfam: AvrRpt-cleavage
Other DBs
NCBI-GeneID: 4334782
NCBI-ProteinID: XP_015628178
UniProt: Q852C9 B9F7L2
LinkDB
Position
3:35689400..35692299
AA seq 242 aa
MAHKGVPKFGSWEDEDRGEHLYTQYFENARKGKSPGRSVNPNNHHGDTEALSKASPLHAG
SDPAMRKPKDDRRSNREGDLRQHETTVRKPYAESPNHRYGDHTNYDNAVRKTGIEKSPVH
PRHQARAANKGGVSSPSRDRRGSLEGNRGSAPTTPGRSKFRSTGRGDETPDRGSAVPKFG
EWDEKDPSTGEGFTDIFEKVREEKQSGTGNAPVMTSEADYIKRYQQRKYESTGCSCFSWF
KN
NT seq 729 nt   +upstreamnt  +downstreamnt
atggcccataaaggagttcctaaatttggaagctgggaggatgaagaccgtggtgaacac
ctctacacacagtatttcgaaaatgcccgcaagggtaaatctccagggaggtctgttaat
ccaaacaatcatcatggagatactgaagcactctctaaggcctctcccctgcacgctgga
tctgatccagccatgagaaagcccaaggatgacagacgctcaaaccgagaaggtgatctt
cgtcagcacgaaaccactgttcgaaaaccatatgctgagtcacctaatcatagatatggg
gatcataccaactatgacaatgctgtgagaaaaaccggcatagagaagtcacccgttcat
ccccgtcaccaggcaagagctgcaaacaagggtggagtttcgtctccttcacgtgaccgt
aggggttcattggaaggaaaccgtggatctgctcccactacacctggaaggtccaagttc
agatcaactggccgtggtgatgagacgcctgatagaggatcagccgtgccaaagtttgga
gaatgggatgagaaagatccttctacaggtgaaggtttcactgacatatttgagaaggtg
agggaggagaaacagtctggtaccggcaacgctcccgtcatgaccagcgaggcagattat
atcaaacgctatcaacaacgcaaatatgaatccacaggctgctcatgcttcagttggttc
aagaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335624
Entry
4335624           CDS       T01015                                 
Name
(RefSeq) RPM1-interacting protein 4
  KO
K13456  RPM1-interacting protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4335624
SSDB
Motif
Pfam: AvrRpt-cleavage
Other DBs
NCBI-GeneID: 4335624
NCBI-ProteinID: XP_015636343
UniProt: Q0JDT2 A0A0P0W9F5
LinkDB
Position
4:18547283..18550982
AA seq 224 aa
MAQPDIPAFGNWDTTGNTPYTQKFENARKNKKAGISSHPNDPRRHPEPPSKSPLHPAYTP
DAQGQSPMNPQHGRRQEADPHRRHSLSQQREVGGGIGSAPRSPYRMVHGSASPAQPNNPS
KPKHRSSGMQTPERRASSEGHGQHTPRRSRDKQGGRGYDAPEDDVAVPPFGEWDEGNAAS
GEKFTGIFNRVRDDKLSPNTSTRQPDTNRSQENKVKQTCPCCIL
NT seq 675 nt   +upstreamnt  +downstreamnt
atggcacaacctgacattccagcatttgggaactgggacaccactggcaacacaccatac
acacagaagtttgagaatgcccgcaaaaacaagaaagcgggcatttcttcccatcccaac
gatccaaggaggcaccctgaacctccatccaagtcacctttgcatccagcatacacacct
gatgctcaggggcagagtccaatgaatccacagcatggaagaaggcaggaagctgatccc
catcgacggcattcgctttctcagcagcgagaggtaggcggtggcatcggtagcgcaccg
agaagcccatacaggatggttcatggctccgcttcaccagcgcagccgaacaacccatcg
aagccgaagcacaggtcatctggaatgcagactccagagaggagggcttcatcggaggga
catggccagcatactcctaggaggagcagggacaagcagggtggccgaggctatgatgca
cctgaagatgatgtagctgttccaccgtttggtgagtgggatgagggtaatgcagcatca
ggcgaaaaatttactggtatcttcaacagggtgagggatgataaattatcgccaaacact
tctaccaggcaaccggacactaatcgcagccaggaaaacaaagtgaaacagacatgccct
tgctgtatactttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346097
Entry
4346097           CDS       T01015                                 
Name
(RefSeq) RPM1-interacting protein 4 isoform X1
  KO
K13456  RPM1-interacting protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4346097
SSDB
Motif
Pfam: AvrRpt-cleavage
Other DBs
NCBI-GeneID: 4346097
NCBI-ProteinID: XP_015648485
LinkDB
Position
8:complement(26192764..26196135)
AA seq 252 aa
MAQQQKKNAHVPKFGNWDNGGNVPYTVYFENARKGKVAAAGKMFNPNDPVDNPEAFSSSI
AAPSPSRAPPPPPSHHERAPSDAPPPPPPAPYAGGSPYHRHAAGGGETPPARRGGGRTSG
GGGSSYSVEHSPSPSPLHPYSDSGSGSYGGGLVANSRAKGGGGGAPRGNETPTRGSAVPR
FGDWDSNPASADGYTHIFNKVREEKQTGQAAGKPAAGLGKGGAAAAGHGNAAKRYHDDDF
ASTKCSCFGWCK
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcgcagcagcagaagaagaacgcgcacgtgccgaaattcggcaactgggacaatggc
ggcaacgtgccgtacaccgtctacttcgagaacgcgcgcaagggcaaggtcgccgccgcc
ggcaagatgttcaaccccaacgaccccgtcgacaacccggaggccttctcctcctccatc
gccgcgccatcgccgagccgagcccctcctcctccgccgtcccaccacgagcgcgccccg
agcgacgcgccgccgccgccgccgccggccccctacgccggcggctcgccgtaccaccgc
cacgccgctggtggtggcgagacgccgccggcaagaagaggaggcgggcggacaagcggc
ggcggcgggtcgtcgtacagcgtcgagcactcgccgtcgccgtcgccgctgcacccctac
tccgacagcgggagcggcagctacggcggcggcctcgtcgccaactcccgcgccaagggc
ggcggcggcggcgccccgcgcggcaacgagacaccgacgagggggtcggcggtgccgcgg
ttcggcgactgggactcgaacccggcgtcggcggacggctacacgcacatcttcaacaag
gtgagggaggagaagcagaccggccaggccgccgggaagccggcggcggggctcggcaag
ggcggcgccgccgccgccggccacggcaacgccgccaagcgataccacgacgacgacttc
gcctccacgaagtgctcctgctttggatggtgcaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268959
Entry
9268959           CDS       T01015                                 
Name
(RefSeq) RPM1-interacting protein 4
  KO
K13456  RPM1-interacting protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    9268959
SSDB
Motif
Pfam: AvrRpt-cleavage
Other DBs
NCBI-GeneID: 9268959
NCBI-ProteinID: XP_015623426
LinkDB
Position
2:17948367..17951984
AA seq 243 aa
MTSQGGVPTFGNWSAAGDTPYTQKFENLRRSKKTATGVYSNPNEVITETPDQPPPPLRSP
LHPSSHDALNQRQRYERKPETGHPRPAGSPLHRETVARRHANPLQQHHLDHGGYGGSPRS
PYREVAAAAAASPRSRYRSAGMQTPDRKASSSDGRVPVTPGRSRLKQGGRGFEPALDEVT
VPPFGDWDDANAASGEKYTGIFNRVRRDKLTPNSSVKQQPPSSPSGGRRQEHKVQQACSC
CIL
NT seq 732 nt   +upstreamnt  +downstreamnt
atgacgtcgcaaggaggagttcctacattcgggaactggtcagccgcaggcgacaccccg
tacacgcagaagtttgagaacctgagaaggagcaagaaaactgctaccggtgtttactcc
aacccaaatgaagtgatcactgaaacacctgatcagcctcctcctcctctcaggtcacca
ctgcatccatcctctcatgatgccctgaaccaaaggcagaggtatgaaagaaagcccgaa
accggccatccccggcctgccggatcgcctctccaccgcgaaaccgtggcgagacggcac
gccaatccgctgcagcagcatcatctggaccatggtggctatggtggctcacccagaagc
ccttacagagaagttgcagctgctgctgctgcctctccaaggtccaggtacaggtcagct
gggatgcagactccagataggaaggcctcttcatctgatggccgtgtcccagtgactcca
ggaaggagcaggttgaagcaaggaggcagaggctttgaacctgctttagatgaagtgact
gtacctccatttggtgattgggatgatgctaatgcggcatctggggagaagtacaccggc
atttttaacagggttaggcgtgataagctgaccccaaactcttctgtcaagcagcaacca
ccatcttctccttctggtggcagaagacaggaacataaagtgcaacaggcctgctcatgc
tgcatcctgtga

DBGET integrated database retrieval system