KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334802
Entry
4334802           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 12 homolog A isoform X1
  KO
K03035  26S proteasome regulatory subunit N5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4334802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4334802
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4334802
SSDB
Motif
Pfam: PCI RPN5_C DUF6104 RPN7 DUF4376
Other DBs
NCBI-GeneID: 4334802
NCBI-ProteinID: XP_015630441
LinkDB
Position
3:complement(35834084..35838016)
AA seq 444 aa
MQEGNSTNLDAAIESLLNVEKQMRLAGDVAGTRKAAIDIVELCYKAGAWKTLNDQIVVLS
KRRGQLKQAITAMVQKAMEYIDLTPDMDTRIELIKTLSSVSAGKIYVEIERARLIKRLAK
IKEEQGQIDEAADLMQEVAVETFGSMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISP
RVFDADPSKEKKKPKEGDNIVQEAPAEIPSLLELKRIYYELMIRYYSHNNDYLEICRCYK
SIYEIPSIKEDPSKWIPVLRKICWYLVLAPHDPMQSSLLNATLEDKNLSEIPNFRLLLKQ
LVTMEVIQWTSLWEFFKDEYANEKNFLGGALGDKAAEDLKLRIIEHNILVVSKYYSRITL
KRLADLLCLSLQEAEKHLSDMVNSKSLIAKIDRPMGVVCFRTAQDSNGILNSWAANLEKL
LDLVEKSCHQIHKETMIHKAVLKA
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcaggagggtaacagtaccaacctcgatgcggcgatagagtcgctcctcaacgtggag
aagcagatgaggctggccggcgatgtcgccggcacgaggaaggccgccatcgacatcgtc
gagctctgctacaaggccggcgcctggaagacgctcaacgatcagatcgtggtcctctcc
aagaggaggggccagcttaagcaggctatcactgccatggttcagaaagcaatggagtac
attgacttaacgccagacatggacacacgtattgagctaatcaagacgttgagcagtgta
tctgctggaaaaatatatgtggagatagagagagcaagattgatcaaaagacttgcaaaa
atcaaagaggagcagggacagattgatgaggctgctgatttaatgcaagaagttgctgtt
gaaacatttggctccatggcaaagacagaaaagattgcattcattctagagcaggtccgg
ctgtgcttggatcgtcaagattatgtacgcgcacagattttatccaggaaaatcagtcct
agggtatttgatgcagacccgtcaaaggaaaaaaagaaaccgaaagaaggtgataatatt
gttcaggaagccccagcagagataccttccctcctggaactgaagcgcatctactatgaa
ctgatgattcgctattactcgcacaacaatgattacctggaaatctgccgttgctacaag
tcgatttatgaaattccatcaataaaagaggatccatcaaagtggataccggttcttaga
aagatctgttggtatttggtgttggcgcctcatgatccgatgcaatcaagccttctcaat
gccacactcgaagacaaaaatctctccgagataccaaatttccggttactgctgaagcaa
cttgtaaccatggaggtgattcagtggacaagcttgtgggaattctttaaagatgaatat
gcgaatgagaagaattttctcggaggagctttgggtgacaaagctgcagaggatctgaaa
ttgaggatcattgaacataatatcttggttgtttcgaagtactattcaaggattaccctg
aagaggctcgcagatcttctttgcttgagcttgcaggaggcagagaaacacctttcggac
atggtaaactcaaagtcgctgattgcgaagattgacaggccaatgggtgttgtatgcttc
cgcacagcacaagacagtaatggtatactcaattcctgggcggcgaacctcgagaaactc
ctcgatcttgttgagaagagctgtcaccaaatacacaaggagacgatgatccataaggcg
gtgttgaaagcttaa

DBGET integrated database retrieval system