KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334806
Entry
4334806           CDS       T01015                                 
Name
(RefSeq) pantoate--beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00410  beta-Alanine metabolism
osa00770  Pantothenate and CoA biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4334806
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    4334806
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     4334806
SSDB
Motif
Pfam: Pantoate_ligase FAD_syn
Other DBs
NCBI-GeneID: 4334806
NCBI-ProteinID: XP_015628253
LinkDB
Position
3:35864747..35867797
AA seq 335 aa
MHAVSPCPLLSDSSSPLIDWTTMAAPREPEVIRDKAAMRAWSRRRRAEGKTVAVVPTMGY
LHQGHLSLISAAAAAASADPVAIVVTIYVNPSQFAPSEDLATYPSDFAGDLRKLASTGVV
DAVFNPPDLYVRGAGRRGAASGGAISCLEEAAGDGHETWVRVERLEKGMCGASRPVFFRG
VATIVSKLFNIIEPDVAVFGKKDYQQWRVICRMVRDLDFAIEIIGSEIVREADGLAMSSR
NVHLSREEREKALSISRSLVDARTGALKGNTDCKQIKNKIVQTLTETGGQVDYVEIVEQE
SLVPVEQIDGPVVICVAAWFGKVRLIDNIEIDTRS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgcacgcagtttctccctgtccacttctgtccgattcctcctcacctcttatcgattgg
acgaccatggcggcgccgcgcgagccggaggtgatccgcgacaaggcggcgatgcgcgca
tggtcgcgccgccgccgcgccgagggcaagaccgtcgcggtcgtacccaccatgggctac
ctccaccaaggccacctctccctcatctccgccgccgccgccgccgcctccgctgatccc
gtcgccatcgtcgtcaccatctacgtcaaccccagccagttcgcgccctcagaggacctc
gccacctacccttccgacttcgccggtgacctccgcaagctcgcctccaccggcgtcgtg
gatgccgtcttcaacccccctgacctctacgtccgtggcgccggtcgccgcggcgccgcc
tccggaggcgcgatctcctgcctggaggaggcggccggggatgggcacgagacgtgggtt
cgggtggagcgattggagaaggggatgtgcggggccagccgtcccgtgttcttccgaggc
gtggccaccatagtctccaagctgtttaacatcatcgagccggatgttgctgtgttcggg
aagaaggattatcagcagtggcgcgtcatctgccgtatggttcgtgatcttgattttgcc
atagagataataggatcagaaattgtgcgagaagctgatggtcttgccatgagctcccgg
aatgtgcacctatcacgcgaggagagggaaaaggcattatccatcagtagatcactggtt
gatgctagaactggcgccttgaagggaaacactgattgcaaacaaatcaaaaacaaaata
gtacagacactaactgaaactggcggtcaggttgactatgttgagatcgtggagcaagaa
agtttggtccctgtagaacagatcgacggccctgtggtcatttgcgttgcggcgtggttt
ggaaaggtcaggctgatcgataatatcgaaatcgatacacgatcctga

DBGET integrated database retrieval system