KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335227
Entry
4335227           CDS       T01015                                 
Name
(RefSeq) sedoheptulose-1,7-bisphosphatase, chloroplastic
  KO
K01100  sedoheptulose-bisphosphatase [EC:3.1.3.37]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4335227
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.37  sedoheptulose-bisphosphatase
     4335227
SSDB
Motif
Pfam: FBPase FBPase_C
Other DBs
NCBI-GeneID: 4335227
NCBI-ProteinID: XP_015633459
UniProt: A0A8J8Y1G5 B9F813
LinkDB
Position
4:complement(9075217..9077883)
AA seq 392 aa
METVAAASYTRGAATRSPACCAAMSFSQSYRPKAARPPSTFYGESLRVNTARSLPSGRQS
KAASRAALSTRCEIGDSLEEFLTKATPDKNLIRLLICMGEAMRTISFKVRTASCGGTACV
NSFGDEQLAVDMLADKLLFEALEYSHVCKYACSEEVPELQDMGGPVDGGFSVAFDPLDGS
SIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTYIIALKDCPGTHEFLLLD
EGKWQHVKDTTTIGEGKMFSPGNLRATFDNPEYDKLINYYVKEKYTLRYTGGMVPDVNQI
IVKEKGIFTNVTSPTAKAKLRLLFEVAPLGFLIEKAGGYSSDGKQSVLDKVINNLDERTQ
VAYGSKNEIIRFEETLYGSSRLTAGATVGAAA
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggagacggtggccgcggccagctacacccgcggggcggcgacgcgctcgccagcgtgc
tgcgccgccatgtccttctcgcagtcctacaggcccaaggccgctagaccgccgagcacg
ttctacggcgagtcgctgcgggttaacacggcgaggtcgctgccgtctgggaggcagtcc
aaggcggcgagccgggcggcgctcagcacccggtgcgagatcggggacagcctggaggag
ttcctgaccaaggcgacgccggataagaacctcatcaggctgctcatctgcatgggggag
gcgatgaggacgatctcgttcaaggtcaggacggcgtcgtgcggcggcaccgcctgcgtc
aactccttcggtgacgagcagctcgccgtcgatatgctcgccgacaagctcctcttcgag
gctctggaatactctcatgtctgcaagtatgcgtgctccgaggaagtcccggagctgcaa
gacatgggtggaccagtcgatggtggtttcagtgtagcattcgaccctcttgatgggtcc
agcattgtcgacacgaacttcacagttggaaccatatttggtgtctggcctggtgacaag
ctgacaggcgtcaccggtggagaccaagttgctgctgccatgggcatctatggccctcgc
actacttacattatcgctctcaaagattgtcctggaactcatgaattccttcttcttgat
gaaggaaaatggcagcatgtcaaggacaccacaaccattggagaggggaaaatgttctct
cctggtaacctgagggctacatttgataatcctgaatatgacaagctcatcaactactat
gtcaaggagaagtacacattgcgttacactggaggaatggttcctgatgtcaaccagatc
atagttaaggagaagggcatcttcaccaacgtgacgtctccgacagccaaggccaagctg
aggctcctgttcgaggtggcgccgttgggtttcttgatagagaaagccggcgggtacagc
agcgacggcaaacagtcggtgctggacaaggtgatcaacaacctcgacgagcggactcaa
gtggcctacggttccaagaacgagatcatccggttcgaggagactctctacggctcgtcg
aggctcaccgccggcgccaccgtgggcgccgccgcctaa

DBGET integrated database retrieval system