KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335435
Entry
4335435           CDS       T01015                                 
Name
(RefSeq) dnaJ protein ERDJ2A
  KO
K09540  translocation protein SEC63
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4335435
   04141 Protein processing in endoplasmic reticulum
    4335435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:osa03110]
    4335435
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4335435
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP40 / DNAJ
   4335435
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4335435
SSDB
Motif
Pfam: Sec63 DnaJ DUF2254
Other DBs
NCBI-GeneID: 4335435
NCBI-ProteinID: XP_015636461
UniProt: Q7XVN7
LinkDB
Position
4:13834706..13841291
AA seq 681 aa
MAAAEENSSLFLIFILTMIALPLVPYTIMRLCRAANVKAKTIHCRCSGCHRSGKYRKSIY
KRISNFSTCSNLTILLLWIVMIFLVYYIKHVSREVQVFEPYSILGLEPGASESDIKKSYR
RLSIQYHPDKNPDPEAHKYFVEFISKAYQALTDPVSRENYEKYGHPDGRQGMQMGIALPK
FLLNMDGASGGIMLLGIVGLCILLPLMIAVIYLSRSSKYTGNYVMHQTLSTYYYFMKPSL
APSKVMDVFIKAAEYMEMPVRRSDDEPLQKLFVAVRSELNLDLKNIRTEQAKFWKQHPSL
VKMELLIQAHLTGESFALTPALLKDYRHMLELAPRLLDELVKIALLPRSPHGFGWLRPAI
GVIELSQNIIQAVPLSARKASGGNSEGIAPFLQLPHFTETVVKKIARKKIRSFQEFCDMP
VEERATLLTQVAGLSDEGAQDVELVLEMIPSIEVDIKCETEGEEGIQEGDVVTMYAWVSL
HRRNGLTAALPHAPSFPFHKEENFWLLLADAASNEVWLSQKVSFMDETTAITAASKAIQE
TQEALGASAKEIGIAIREAVDRVKKGSRLVMGKFQAPAEGTHNLTSFCLCDAWIGCDTKT
SLKLKVLKRSRAGTRGHVAEEGPVAEDGIEEEEEEEEEEYDDYESEYSDDEEDEKSKGKG
KVANGVAHQKANSDIDSGSDD
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggcggcggcggaggagaacagctcgctgttcctcatattcatcctcaccatgatcgcg
ctccccctcgtgccctacaccatcatgcgcctctgccgcgccgccaacgtcaaggccaag
accatccactgccgctgctccggctgccaccgctccggcaagtaccgcaagtcgatctac
aagaggatatccaacttctcgacatgcagtaacctcaccatcctgcttctctggatagtt
atgatcttccttgtatactacatcaagcatgttagccgcgaggtacaagtgtttgagccg
tatagcattcttggactggaaccaggtgcatcagagtctgatatcaagaaatcataccgt
agactttctatccaataccatcctgataaaaatcctgatcctgaggcccacaagtacttt
gttgaatttatatccaaggcatatcaggctttaactgatcctgtatctcgtgaaaactat
gagaagtatggtcacccagatggacgccaggggatgcaaatgggcattgctttgcccaag
ttcttgttgaatatggatggtgcatctggtggaataatgcttcttggaatagtagggcta
tgcatactcttgcccttgatgatagcagttatttatttgtcaaggtcatcaaagtacacc
ggaaattatgtcatgcatcaaactctgtccacttattactacttcatgaagccttcactg
gctccaagcaaagtcatggatgtcttcattaaggctgcagagtatatggagatgccagtc
cggcgcagtgacgatgaacccttgcagaaattatttgtagctgttaggagtgaattaaat
ctagacttgaagaatattagaacagaacaagctaaattctggaagcagcatccatctcta
gtgaagatggagcttttgattcaggctcacctcactggagagtcatttgctttgacacca
gcgttactgaaggattacaggcacatgcttgaacttgcacctcgtcttctggatgaactt
gtcaagattgcactactaccaaggagtccccatggttttggatggctcaggcctgcaatc
ggtgtaattgagctttcccaaaatatcatccaggctgtccctctcagtgcacgaaaagct
agcggaggcaactctgaaggaatagcacctttcttgcagctaccgcattttactgaaacg
gttgtcaaaaaaattgctcgcaagaaaatccgttcattccaagaattctgtgacatgcct
gtggaggaacgcgccacgttgctgacacaggttgctgggctttctgatgaaggtgctcaa
gatgtagagcttgtgctggagatgattccttctattgaagtggatattaaatgtgagact
gaaggcgaagaggggattcaagagggtgatgttgtgaccatgtatgcttgggtctcactt
caccgtcgcaatggcctaactgctgctcttccccatgctccttccttcccgttccacaag
gaagagaacttctggttgcttctagcagatgctgcatcgaatgaagtttggttatcccag
aaggtcagcttcatggatgagactaccgctataactgcagcatcaaaagctatacaagag
acccaagaagcactaggtgcaagtgcaaaggaaatagggattgcgattagagaggcagtc
gacagggtgaagaaaggcagtaggttggtaatgggcaagttccaagccccggccgagggc
actcacaacctgacttccttctgtttgtgcgacgcatggataggatgtgacaccaagacc
agcttgaagttgaaggtcctgaagcgcagccgggcaggaacaagaggtcatgtggctgaa
gaaggcccagtggcagaggatggtattgaggaagaagaagaggaggaagaagaggagtac
gacgactacgagagcgagtacagcgatgacgaggaggatgagaagagcaaaggaaagggt
aaggtcgcgaacggagtagcccaccaaaaggcaaactccgatatagattctggcagtgat
gattga

DBGET integrated database retrieval system