KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335542
Entry
4335542           CDS       T01015                                 
Name
(RefSeq) cell division cycle 5-like protein
  KO
K12860  pre-mRNA-splicing factor CDC5/CEF1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4335542
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4335542
   03400 DNA repair and recombination proteins [BR:osa03400]
    4335542
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4335542
 Complex C
   Prp19-CDC5 complex
    4335542
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    4335542
SSDB
Motif
Pfam: Myb_Cef Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 4335542
NCBI-ProteinID: XP_015636290
UniProt: A0A0P0W9C3
LinkDB
Position
4:16579875..16587190
AA seq 972 aa
MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT
EWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPNDDPR
KLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR
LASLQKRRELKAAGIDTRQRKRKRKGIDYNAEIPFEKRPPPGFYDTVGEDRPLEHVQFPT
TIEELEGKRRVDIEAQLRKQDIARNKILQRQDAPAAIMQANRLNDPEAVTKRSKLMLPPP
QISDHELEEIAKMGNAGDPSLVEELGEGSTATRALLSSYSQTPRLGMTPLRTPQRTPAGK
GDAIMMEAENLARLRESQTPLLGGDNPELHPSDFSGVTPRKKEMQTPNPMATPLASPGPG
ATPRIGMTPSRDGSSFGLTPKSTPFRDELRINEEVDMQDTAKLELRRQAELRKSLRSGFA
SIPQPKNEYQIVMPPITEEEKEEAEEKIEDMSDRLARERAEEQARQEALLRKRSKVLQRS
LPRPPAASIEILRQTLIKGGESRSRSTFVPPTSLEQADELINEELLRLLEHDNAKYPLDE
KTQKDKKKGSKRQANGTPSVPEIEDFDEDELKEANSMLEEEVQYLRVAMGHESESLEDFV
KAHDACQEDLMFFPNNNSYGLASVAGNSDKIAALQYEFEIVKKRMDDEAKKASRLEQKIK
LLTQGYQVRAGKLWSQVQDTFKQMDTSATELECFQELQKQEQMAASYRIRNLTEEVNKQK
ALERTLQSRYGDLLTSYKRIQEQLEEHKRQLMIQEEMEAQKRAQEEEEMEAQKRTQAEEE
KEAAKAEEEARKMDRAADEEAAGSKQVNEDQMDVDNSNADGDEFVGPIPPGPGTQGDDNV
VAVEENSSSQSGDTATTEDGSCGMIDASKSGGQDHIDSKDELPTVGASLDDGSAAASSDQ
DVSTEVNATVPE
NT seq 2919 nt   +upstreamnt  +downstreamnt
atgaggatcatgataaagggcggggtgtggaagaacacggaggacgagatcctcaaggcc
gccgtgatgaagtacggcaagaaccagtgggcgcgcatctcgtccctcctcgtccgcaag
tccgccaagcagtgcaaggcccgctggtacgagtggctcgacccctccatcaagaagact
gaatggacaagggaagaggatgagaagttactgcatcttgctaaactcatgcctacgcag
tggaggacaattgcacctattgttggtcgaacaccatctcagtgccttgagcgttatgag
aaacttcttgatgctgcctgtgcaaaggatgagaattatgagcctaatgatgatccaagg
aagttacggcctggtgagattgacccgaaccccgagtcaaaacctgcacgtcctgatcct
gttgatatggatgaagatgaaaaggagatgctttctgaggcaagggctcgcttagctaac
accaggggtaaaaaggcaaagcggaaggcaagagagaaacaacttgaagaggcaaggcga
cttgcctcactgcagaaaaggagagaattaaaggcggctggtattgatacacggcagagg
aagagaaagagaaagggtatcgattataatgctgagattccttttgaaaagaggccgcct
ccaggtttttatgatactgttggtgaggacaggccacttgagcatgtacagttcccaacc
actattgaggagcttgaaggtaagagaagagtagacatagaggcacaattaagaaaacaa
gacattgccaggaacaagattctccagaggcaggatgctcctgctgcaattatgcaggca
aatagactcaacgatccagaagctgtcacaaagaggtccaaattaatgcttccaccaccc
caaatctctgatcatgagctagaagagatagcaaagatgggtaatgctggtgatccttct
ttagttgaggaacttggcgaaggtagtactgccacaagagcattgctttctagttattcc
caaactccaagacttggaatgacaccattgcggacgccacaacgaactccagctgggaag
ggtgatgctattatgatggaggcagaaaatctagcgcgtctaagggagtctcagacccct
cttttaggaggggataacccggagcttcacccatcagatttctctggtgttacaccacgt
aagaaggaaatgcagactccaaatccaatggcaacacctttggcaagccctggccctggt
gctactccaagaattggaatgacaccctccagagatggaagttcttttggtttaactcca
aaaagtactcctttccgagatgagcttcgcataaatgaagaggtggatatgcaagatact
gctaaacttgagcttcgtaggcaagctgaattgagaaaaagcctacgatctgggtttgct
tctattccacagcctaagaatgagtaccagatagttatgccacctatcacggaggaggag
aaggaagaagctgaagagaaaattgaggatatgtcagacaggcttgcacgagagagggct
gaggaacaagcaaggcaggaagccttgctcagaaagagatccaaagttttgcagaggagc
ttgccaaggccaccggcagcttctatagaaattctccgacaaactctaattaagggtggt
gaaagcagaagcaggagcaccttcgtgcctcctacatcacttgaacaagctgacgaacta
ataaatgaggagcttcttcggctccttgagcatgataatgctaaatatcctctagatgag
aaaactcaaaaggataaaaagaaaggaagcaagcgccaggcgaatgggactccttctgta
cctgagattgaagattttgatgaagacgaattaaaagaggccaattctatgcttgaggag
gaggttcaataccttcgtgtcgccatgggacatgaaagtgaatctttggaagattttgtg
aaagcacatgatgcatgccaagaggaccttatgttttttccaaataacaacagctatggt
cttgccagcgttgctggaaattctgataagatagctgctttgcaatatgagtttgaaatt
gtgaagaagagaatggatgatgaagctaagaaggcttcgcggcttgagcagaaaatcaag
cttctgacacaaggataccaggtacgagctggtaaactctggtcacaggttcaagataca
ttcaagcagatggacacttcagcaacagagcttgaatgctttcaagagctgcagaagcag
gaacagatggctgcatcttatcgtataagaaatttgactgaagaagtaaacaaacagaaa
gcattagaacggactctccaaagccgctatggtgatctgttaactagttacaagaggatc
caagagcagcttgaggagcataagaggcaactgatgatacaggaggaaatggaagcacag
aagcgtgctcaggaggaggaggaaatggaagcacagaagcgtacgcaggcagaggaagaa
aaagaagcggcgaaagctgaagaggaagcaagaaagatggatagggctgctgatgaagaa
gcggcaggaagcaaacaagtcaatgaggatcagatggatgttgacaactctaatgctgat
ggtgatgaattcgtaggtccgattcccccaggaccaggtactcaaggtgacgacaatgtg
gtggcggtcgaagagaactctagctcgcagagcggtgatactgctaccacggaagatgga
tcttgtggcatgatcgacgcatcaaaatcaggaggtcaggatcacatcgacagcaaggat
gaacttcccactgttggtgccagtctagatgatggaagtgctgctgcatcttctgatcaa
gatgtctcaactgaggtgaatgccactgtccctgaatag

DBGET integrated database retrieval system