KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335963
Entry
4335963           CDS       T01015                                 
Name
(RefSeq) sm-like protein LSM1B
  KO
K12620  U6 snRNA-associated Sm-like protein LSm1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4335963
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4335963
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4335963
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     4335963
SSDB
Motif
Pfam: LSM Hfq
Other DBs
NCBI-GeneID: 4335963
NCBI-ProteinID: XP_015633580
UniProt: B9FFE2 Q0JCW8
LinkDB
Position
4:22223718..22227191
AA seq 129 aa
MSSWAGPDEIFLSTSLAGFLDKKLIVLLRDGRKLLGTLCSFDQFANVVLQGACERVIVGE
LYCDVPLGLYVIRGENVVLIGELDREKDELPAHMTCVSEAEIRKAEKAEREARDLKGSMR
KRMEFLDFD
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcgtcgtgggccgggcccgacgagatcttcctctccacgtccctggccggcttcttg
gacaagaaacttattgtcctactacgagatggacggaagctgcttggcacactctgctca
tttgatcagtttgcaaatgttgttcttcagggtgcttgtgaacgagtaattgtaggtgaa
ctatattgtgatgttcctcttggtctatatgtgatccggggagagaatgtcgtattaatc
ggagaattggatcgtgagaaggatgaactccctgctcacatgacttgtgtttcagaggct
gaaataagaaaggccgagaaagcagaaagggaagcgagagatctgaaaggttcaatgagg
aagaggatggagttcttagactttgattag

DBGET integrated database retrieval system