KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336254
Entry
4336254           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase III subunit 1
  KO
K03018  DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4336254
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4336254
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     4336254
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     4336254
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_1 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 4336254
NCBI-ProteinID: XP_015636431
UniProt: Q7X881 Q7FAC6
LinkDB
Position
4:24593234..24604893
AA seq 1383 aa
MARPEEKLRCTKEPFIEDVGTRRIKSIRFSMFSGNEVRQSAEVQVWNSRIYNHEMKPVPN
GLLDTRMGAANKLGECSTCHGSFAECPGHFGYLKLALPVFNVGFFNCILDVLKCICKSCS
RVLLMEKDRLEFLKKMRNPKADPLQKSAIMKKVRDKCKLSRCPWCGFINGVAKKGRAGLI
ILHDCSKTLDGSTEELRDALSHKKEKLSISAVRMLDPAIVLSLFKRMTDEDCELLNLGDR
PEKLIVTEIAVPPVPIRPSVFVAGGRMSNEDSITVILKSIANTNSILKENLQTGGQFMKC
FDCWQHLQLQVVEYINSDAPSLPESQHRGLVQRLKGKTGRFRGNLSGKRTEYTGRTVISP
DPNLRITEVAIPILMARVLTYPERVSYYNIEKLRQCIRNGPHKHPGANFIIQPDGTKLHL
KYCDRRIAARDLKYGCVVERHLEDGDIVLFNRQPSLHRMSIMSHRARIMPWRTLRFNESV
CNPYNADFDGDEMNLHVPQTEEARTEALMLMGVQNNLCTPKNGEILVASTQDFLTSSFLV
TRKDNFYDRSSFSLLCSYLGDAMENIDLPTPALIKPIELWTGKQLFSVLVRPNACTKVFL
NLTVKEKIYKTPKGSTLEPEAMCPNDGFVYFRNSELLSGQVGKATLGNGNKDGMFSTLVR
DYNSHAAASCMNRLAKFSARFIGNHGFSIGVDDVQPGEHLNQEKKMKIDGGYKDCHDLIA
SYSKGALRLQPGCNAAQTLEQSITRVLNEIREEAGKVCMNTLHWRNSPLIMSQCGSKGSP
INISQMVACVGQQSVGGRRAPNGFIDRTLPHFPINSKTPAAKGFVANSFYTGLTATEFFF
HTMGGREGLVDTAVKTAETGYMSRRLMKGLEDLSVFYDQTVRNASGGIVQFLYGDDGMDP
AKMEGKDGKPLNLDQLFMKVMATCPQRGQNTLSPGEILQILNDKLSEHDASSDDGCSEKF
KQLLTYFLEDRIKLLKSTRRALLLDEDHVGERHSSFEESIAANISGISVKQLQVFLDTCL
SRYHLKKIEAGASIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINAAKK
ISTPIITAELLSEKDVLSARIVKGSMEKAVLGEVAEAIKIVLKSSQPNLVVKLDMQRIEA
LHMGISADSVQLSILNHPKIKLKSEHVRVIDKSKLRIYPAGIDKSKLLYELHHLKSMLPK
VIVKGIPTVERAVISETGEENDKRYKLLVEGTNLLAVMGTPGVDAMKTKSNHIMEVNRTL
GIEAARRSIIDEIQYTMKSHGMNIDSRHMMLLADLMTYKGEILGITRYGIAKMKSSVLML
ASFEKTAEHLFNASYSGREDQIEGVSECIIMGIPMQLGTGILKVRQRLDHLPEFKYQPDP
ILA
NT seq 4152 nt   +upstreamnt  +downstreamnt
atggcgcggccggaggagaagctgcggtgcacgaaggagcccttcatcgaggatgtcggc
acgcggaggataaagagcatccggttcagcatgttctcggggaacgaggtgcgccaatcc
gcggaggtgcaggtttggaacagccggatctacaaccatgagatgaagccggtgcccaat
ggattgctcgacacgcggatgggtgcggcaaacaagcttggggagtgcagtacttgccat
ggttcatttgctgaatgcccgggtcattttggttacttgaagctcgcccttccagttttt
aatgttggattctttaactgtattttggatgtattgaagtgcatctgcaagagctgcagc
agggttcttcttatggagaaagatcggctagagtttttgaagaaaatgagaaatcccaaa
gcagatccgctacagaaaagtgctatcatgaaaaaagtgagggacaaatgcaaactatcc
cgttgcccctggtgtggattcataaatggtgttgctaaaaagggcagagcagggttgatt
attcttcatgattgtagcaaaacattggatggaagcacagaagagcttcgggacgcacta
tcacataagaaagagaaactatctattagtgctgttcgcatgctagaccctgcaattgtt
ctatctcttttcaaaagaatgaccgatgaggattgtgagttgctaaacctcggtgatagg
cctgagaaacttattgtgacagagattgcagtgccacctgtacctatacgtccttctgtt
ttcgtggctggtggaagaatgagcaatgaagatagcattaccgtcatattgaagagtatt
gctaatactaattccatccttaaggagaaccttcaaactggtggtcagttcatgaagtgc
tttgattgctggcaacaccttcaacttcaagttgttgaatatatcaacagtgacgcaccc
tctcttcccgagtcacaacatcgaggccttgttcagcgactcaaagggaagacaggccga
tttcgtggtaacttgtctggaaaacgtaccgagtacactggaaggactgtcatttctcct
gatccaaacttgagaataacagaggtggctattcccatcctgatggctcgagttttgact
tatcctgaaagagtttcatactataacatagagaagctgcgtcagtgtatacggaatggt
ccacacaaacatccaggggcaaatttcatcatacaacctgatggaacaaagctgcactta
aagtattgcgatagaagaattgctgctcgagatttgaagtatggctgtgtagtcgaaagg
catttagaagatggagacattgtcctcttcaatagacaaccgagcttgcatagaatgtca
attatgtctcacagggctaggattatgccctggagaacactaaggtttaacgagtctgtc
tgtaacccatataatgctgattttgatggcgatgagatgaatttgcatgttcctcagact
gaggaagcccgcactgaagcgcttatgctcatgggggttcagaacaatttatgtacccca
aagaatggggaaatactggttgcatccacgcaagactttttgacttcctcttttctggtt
acaagaaaagataacttttatgacaggtcgtcattttctctcttatgttcatatcttggt
gatgcaatggaaaacattgatttgccaacacctgctctgattaagcctattgagctttgg
actggtaaacaactcttcagtgtgttagtacgtcctaacgcatgtacaaaggtgtttctg
aatcttactgttaaagagaaaatttataagactcctaagggttcaactctggaacctgaa
gcaatgtgtcccaatgatggttttgtctacttccgaaacagtgaacttctatctgggcaa
gttgggaaggccactttaggtaatgggaataaggatggcatgttctccactcttgtaaga
gattataattctcatgctgcggcaagctgtatgaaccgcttggcaaaatttagtgcaaga
tttatagggaaccatggtttctcaattggtgtggacgatgtccaaccgggagaacattta
aaccaagagaagaaaatgaaaatagatggagggtacaaagattgccatgatcttattgct
tcctattccaaaggtgcactccgtttgcagcccggttgcaacgcagcccaaacattggag
caaagtataactcgtgtactgaatgaaatcagagaagaagctggaaaagtctgtatgaat
acacttcactggaggaacagcccattgatcatgtctcagtgtggatctaaaggttctcca
atcaacattagtcagatggttgcatgtgttggccaacaatcagttggagggcgtcgtgcc
ccgaatggcttcatagatcgaactcttccccactttcctataaattcaaagactcctgca
gccaaaggctttgtcgctaattctttctatactggcttgactgccaccgaattcttcttc
catacgatgggtgggcgagaaggtcttgttgatacagcggttaaaacagctgaaacagga
tatatgtcccgcagattaatgaagggattggaagatctctcagttttctatgatcagacg
gtccgcaatgctagtggtggtattgtacagttcctctatggagatgatggcatggatcct
gcaaagatggaagggaaagatggaaagcccttaaatttggatcaattgtttatgaaagtc
atggccacttgtcctcaaaggggacagaatacattatctccaggtgaaatcttacaaatt
ttaaatgacaagctctctgaacatgatgcctcctctgatgatggttgtagcgaaaagttc
aagcaactgttaacgtattttcttgaggatcgtataaaattgctgaagagcacaaggaga
gcgcttctcctagatgaagatcatgttggagagaggcactccagctttgaagaatccatt
gctgctaatatttctggtatatctgtgaagcaactacaggttttcttggacacatgttta
tctcgttaccacttgaagaaaattgaagccggagcatcaattggggcaattggggctcaa
agtattggagagcctggaactcagatgacattgaaaactttccattttgcaggagtagct
agcatgaatgttactcttggtgttcctcgcatcaaggaaattatcaatgctgctaaaaag
ataagcacacctattatcactgctgagttactttctgagaaggatgtgttgtctgcacgc
attgtgaaaggctctatggaaaaggcagtgctgggtgaggtggctgaagccataaagatt
gtgttgaaatcaagtcaaccaaacttggttgttaaactcgatatgcaacgtatagaagcc
ctgcacatgggcatctctgctgactctgtgcagctgtcaatattgaatcatccaaaaata
aagctaaaatctgagcatgttcgtgttattgataaatccaagttgagaatttatccagct
ggaatagataagtccaaacttctatatgagttacatcatctcaaatccatgcttccaaaa
gtgatcgtgaagggtattccaactgttgaaagagctgtgatcagcgaaactggtgaagaa
aatgacaaaagatacaagttgttggttgagggaacaaatctcttggcagtaatgggtact
ccaggagttgatgctatgaaaacaaaaagtaaccacatcatggaagtgaaccgaacactc
ggaattgaagctgcgaggagatctattattgatgaaattcagtatacaatgaaaagtcat
gggatgaacattgattcgagacatatgatgcttctggcagatttgatgacatacaagggt
gaaattcttggcattactagatatggtattgcaaaaatgaaaagtagtgtgctgatgctg
gcttcgtttgagaaaacagcggagcatctctttaatgcatcatacagtggtcgtgaggat
cagatagagggagttagtgaatgcattatcatgggtatacccatgcaacttggcactggt
attctcaaagtcagacaaaggcttgaccatttgcctgaatttaaatatcagcctgatcca
atattggcgtga

DBGET integrated database retrieval system