KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336317
Entry
4336317           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4336317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4336317
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4336317
SSDB
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Other DBs
NCBI-GeneID: 4336317
NCBI-ProteinID: XP_015633944
UniProt: A0A0P0WBZ4 Q0JBY8
LinkDB
Position
4:complement(25076787..25079073)
AA seq 160 aa
MAEQTERAFLKQPKVFLCPKKTTKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP
FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSKSGAGKKVFTAA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcggagcagactgagagggcattcttgaagcagcctaaggtttttctctgtcctaag
aaaaccaccaaggggaagaagcctggcaagggcgggaataggttctggaagaacattggc
cttgggttcaagacacccagggaagccatcgaaggaacctacattgacaagaaatgccca
ttcactggtactgtatcaattaggggtcgtatcatagctggaacatgtcatagtgctaag
atgaacaggaccattattgttcggaggaattatctgcactttgtcaagaagtaccagagg
tacgagaagaggcactccaatattcctgctcacatttcaccgtgcttccgtgttaaggaa
ggagatcacgtgatcattggccagtgcaggccactgtcaaagaccgtgaggttcaatgtg
ctgaaggtcattccggcagggtcaaagagtggtgcagggaagaaggttttcacagccgct
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336975
Entry
4336975           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4336975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4336975
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4336975
SSDB
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Other DBs
NCBI-GeneID: 4336975
NCBI-ProteinID: XP_015636632
UniProt: Q0D5F2 Q7XIK5
LinkDB
Position
4:31103273..31105340
AA seq 161 aa
MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP
FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSTGGSGGKKAFTAA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgagcagactgagaaggctttcctgaagcagccaaaggttttcctcagctcaaag
aagtctggcaagggtaagaagccaggcaagggtggcaaccgcttctggaagagcattggc
cttggcttcaagacccccagggaagcaattgaagggacatacattgacaagaagtgccca
ttcactggaactgtttctatcagaggcagaatcattgctggaacatgccacagtgccaag
atgaacagaactatcattgttcgcaggaactacctccattttgtcaagaaatatcagagg
tatgagaagaggcattccaacattccggctcacgtctccccatgcttccgtgtcaaggaa
ggtgaccatgtcatcattggccagtgcaggccgctgtcgaaaactgtgaggttcaacgtc
ctgaaggtcatcccagctggatccaccggcggcagcggcggcaagaaggccttcaccgca
gcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336976
Entry
4336976           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4336976
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4336976
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4336976
SSDB
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Other DBs
NCBI-GeneID: 4336976
NCBI-ProteinID: XP_015636633
UniProt: Q0D5F2 Q7XIK5
LinkDB
Position
4:31105970..31107929
AA seq 161 aa
MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP
FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSTGGSGGKKAFTAA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgagcagactgagaaggcattcctgaagcagccaaaggttttcctcagctcaaag
aagtctggcaagggtaagaagccaggtaagggtggcaaccgtttctggaagagcattggc
cttggcttcaagactcccagggaagcaattgaagggacatacattgataagaagtgccca
ttcactggaactgtttctatcagaggcagaatcattgctggaacatgccatagtgctaag
atgaacaggactatcattgttcgcaggaactacctccactttgtgaagaaatatcagagg
tatgagaagaggcattccaacattccggctcacgtctccccatgcttccgtgtcaaggaa
ggtgaccatgtcatcattggccagtgcaggccgctgtcgaaaactgtgaggttcaacgtc
ctgaaggtcatcccagctggatccaccggcggcagcggtggcaagaaggcctttaccgca
gcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343620
Entry
4343620           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343620
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4343620
SSDB
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Other DBs
NCBI-GeneID: 4343620
NCBI-ProteinID: XP_015646984
UniProt: Q0D5F2 Q7XIK5
LinkDB
Position
7:complement(22654637..22656603)
AA seq 161 aa
MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP
FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSTGGSGGKKAFTAA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgagcagactgagaaggcattcctgaagcagccaaaggttttcctcagctcaaag
aagtctggcaagggtaagaagccaggtaagggtggcaaccgtttctggaagagcattggc
cttggcttcaagactcccagggaagcaattgaagggacatacattgataagaagtgccca
ttcactggaactgtttctatcagaggcagaatcattgccggaacatgccatagtgctaag
atgaacaggactatcattgttcgcaggaactacctccactttgtgaagaaatatcagagg
tatgagaagaggcattccaacattccggctcacgtctccccatgcttccgtgtcaaggaa
ggtgaccatgtcatcattggccagtgcaggccgctgtcgaaaactgtgaggttcaacgtc
ctgaaggtcatcccagctggatccaccggcggcagcggcggcaagaaggccttcaccgca
gcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344935
Entry
4344935           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344935
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4344935
SSDB
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Other DBs
NCBI-GeneID: 4344935
NCBI-ProteinID: XP_015650405
LinkDB
Position
8:complement(6243960..6247183)
AA seq 159 aa
MAEQTERAFLKQPKVFLCPKKSGKGKKPGKGGNRFWKNIGLGFKTPREAIEGTYIDKKCP
FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHISPCFRVKE
GDHVIIGQCRPLSKTVRFNVIKVIPAGSTGGGKKAFIAA
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcggagcagactgagagagctttcctgaagcagcccaaggtcttcctttgcccaaag
aaatctggcaaagggaagaagcctggcaagggaggtaaccgcttctggaagaatattggc
cttggcttcaagacaccccgggaagcaattgaagggacctacatcgataagaaatgccca
ttcactggaactgtttctatcagaggtagaattattgctggaacatgccacagtgccaag
atgaataggacaatcatcgtacgcagaaactacctccattttgtgaagaaatatcagcga
tatgaaaagaggcactccaacattccagctcacatttctccatgcttccgtgttaaggaa
ggtgaccatgtcatcattggccagtgcaggcctttatcaaaaactgtgaggttcaacgtt
attaaagtcatcccagctggttccacaggtggtgggaagaaagcattcattgcagcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271697
Entry
9271697           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9271697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9271697
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    9271697
SSDB
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Other DBs
NCBI-GeneID: 9271697
NCBI-ProteinID: XP_015646982
UniProt: Q0D5F2 Q7XIK5
LinkDB
Position
7:complement(22657249..22659314)
AA seq 161 aa
MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP
FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSTGGSGGKKAFTAA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgagcagactgagaaggctttcctgaagcagccaaaggttttcctcagctcaaag
aagtctggcaagggtaagaagccaggcaagggtggcaaccgcttctggaagagcattggc
cttggcttcaagacccccagggaagcaattgaagggacatacattgacaagaagtgccca
ttcactggaactgtttctatcagaggcagaatcattgctggaacatgccacagtgccaag
atgaacagaactatcattgttcgcaggaactacctccattttgtcaagaaatatcagagg
tatgagaagaggcattccaacattccggctcacgtctccccatgcttccgtgtcaaggaa
ggtgaccatgtcatcattggccagtgcaggccgctgtcgaaaactgtgaggttcaacgtc
ctgaaggtcatcccagctggatccaccggcggcagcggcggcaagaaggccttcaccgca
gcatga

DBGET integrated database retrieval system