KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336358
Entry
4336358           CDS       T01015                                 
Name
(RefSeq) general transcription factor IIH subunit 2
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4336358
  09124 Replication and repair
   03420 Nucleotide excision repair
    4336358
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4336358
   03400 DNA repair and recombination proteins [BR:osa03400]
    4336358
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4336358
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4336358
SSDB
Motif
Pfam: Ssl1 C1_4 VWA_2 IBR Castor1_N
Other DBs
NCBI-GeneID: 4336358
NCBI-ProteinID: XP_015633683
UniProt: Q7XM94
LinkDB
Position
4:complement(25435274..25438951)
AA seq 432 aa
MYGVGGGGGGFNAPYTASARRRNHEDDDDEEEEESGEGRVLEAWERAYADDRSWEALQED
ESGLLRPIDTKTLVHAQYRRRLLLRSAASAAARIQKGLIRYLYIVIDLSRAASEMDYRPS
RMAVVAKYAEVFIREFFDQNPLSHVGIVTMKDGISHRLTEIGGSPESQIKALMGKLECSG
EPSLQNALELVHGYLDQVPSYGHKEVLFLYSALNTCDPGDIMETIAKCKKSKIRCSVIGL
AAEIFICKYLCEETGGSYTVALDESHFKELLLEHAPPPPAIAEYAAANLIKMGFPQRGAE
DLISICSCHKKIKSGAEGYICPRCKVNVCELPTECRTCGLTLVSSPHLARSYHHLFPVQP
FDEVSSVHPNRLGQKGGQKCYGCQQSFINPDSQSSLHVRCPKCNQHFCLDCDIYIHESLH
NCPGCESQRSSS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtacggcgtcggcggcggcggcggggggttcaacgcgccctacacggcatcggcccgg
cggcgcaaccacgaggacgacgacgacgaggaggaggaggagtccggcgaggggcgcgtc
ctcgaggcctgggagcgcgcgtacgcggacgaccggtcatgggaggcgctgcaggaggac
gagtcgggcctcctccgcccgatcgacaccaagaccctcgtccacgcgcagtaccgccgc
cgccttctcctccgctctgccgcctccgccgccgcccgcatccagaagggcctcatccgc
tacctctacatcgtcatcgatctctcccgggcagcttcagagatggattatcgacctagt
cgaatggctgttgttgcaaaatatgctgaggtattcataagggaattttttgaccagaat
cccttgagtcatgtggggatagtgacaatgaaagatgggatttcccatcgacttacagag
attggaggtagtcctgaatcacagattaaagcattgatggggaagcttgagtgttctggt
gaaccatctctgcagaatgctctagagcttgtccatggttatttagaccaggttccttca
tatggtcacaaggaagtattatttttgtactcggccctgaatacctgtgatcctggagat
atcatggagacaatagcaaaatgcaagaaatccaaaatacgatgttcggttattgggctt
gctgcagagatttttatctgcaaatatctgtgtgaagagactggcggatcctacacagtt
gcactggatgagtcccatttcaaggaattgcttctggaacatgctcctccaccacctgca
attgctgagtatgctgcagctaatttgattaagatgggttttccgcagagaggagcagag
gatcttatctccatctgctcttgtcacaagaaaataaagtcgggggctgaaggttacata
tgtcctagatgcaaagtcaatgtatgtgagcttccaacagaatgtcgaacttgcgggctg
acactagttagctctccacatctggcaaggtcctatcatcatctcttccctgtacaacca
tttgatgaggtgtcctccgtgcacccaaatagactaggtcaaaagggaggacaaaagtgt
tacggctgccagcaaagctttattaaccctgatagtcaatctagcctccatgttcgctgt
ccaaaatgcaaccaacacttctgccttgattgcgatatttacatccatgagagcttgcac
aattgcccaggttgcgagagtcagcgtagttcttcatag

DBGET integrated database retrieval system