KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336402
Entry
4336402           CDS       T01015                                 
Name
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4336402
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     4336402
SSDB
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 4336402
NCBI-ProteinID: XP_015633843
UniProt: B9FG57 Q7X634
LinkDB
Position
4:complement(25826765..25830757)
AA seq 372 aa
MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTAHRFEMEMARITGKEAALFVP
SGTMANLISVLVHCDTRGSEVILGDNSHIHIYENGGISTIGGVHPKTVRNNPDGTMDIDK
IVVAIRHPDGALYYPTTRLICLENTHANCGGKCLSAEYTDEVGEVAKSHGLKLHIDGARI
FNASVALGVPVHRLVKAADSVSVCISKGLGAPVGSVIVGSTAFIEKAKILRKTLGGGMRQ
VGILCAAAYVAVRDTVGKLADDHRRAKVLADGLKKIKHFRVDTTSVETNMVFFDIVDSRI
SPDKLCQVLEQRNVLAMPAGSKSMRLVIHYQISDSDVQYALTCVEKAAEEILTGSKKFEH
LTNGTTRNSYGH
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggtgaccaacgtggtggacctacggtcggacacggtgacgaagccctccgacgcgatg
cgcgccgccatggccgccgcggacgtggacgacgacgtccttggcgccgacccgaccgcg
caccgcttcgagatggagatggcgaggatcacgggcaaggaggccgcgctgttcgtgccg
tccggcaccatggccaacctcatctccgtcctcgtccactgcgacaccaggggcagcgag
gtcatcctcggcgacaactcccacatccatatctacgagaacggcgggatctccaccatc
ggcggcgtccaccccaagaccgtcaggaacaaccccgatggaaccatggacatcgacaag
attgtcgtcgccatcaggcatccggatggggcgctgtattatccgaccacaaggctgatc
tgcctggagaatacccatgcaaactgtggtggaaagtgtctgtctgctgaatatactgac
gaggttggtgaagttgccaagagtcatggtctgaagcttcacatagatggagctcgcatt
tttaatgcttctgtggcccttggagttcctgttcatcgacttgtgaaagctgcggattca
gtctcggtgtgcatatctaaagggttaggcgctcctgttggatcagttattgttggttcg
acggccttcatagaaaaggctaaaattcttaggaagacactaggtggtggaatgaggcaa
gtgggaattctttgtgcggctgcctatgttgccgttcgcgacactgtaggaaaacttgct
gatgaccatagaagggctaaagttttagcagatggtctgaagaaaatcaagcattttaga
gttgatacaacttcagtggagaccaatatggtattctttgatattgtggattcacgcata
tcacctgacaaactgtgtcaagtccttgaacaacgcaatgtgcttgccatgccagcaggc
tcgaagagcatgaggcttgtcatccactaccaaatttctgatagtgatgttcagtatgca
ctgacatgcgtggagaaagctgctgaagaaatactgacaggcagtaagaagtttgaacat
ctgacaaacggtactaccaggaattcatacgggcactag

DBGET integrated database retrieval system