KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336421
Entry
4336421           CDS       T01015                                 
Name
(RefSeq) exosome complex component RRP4 homolog
  KO
K03679  exosome complex component RRP4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4336421
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4336421
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4336421
 Prokaryotic type
  Archeal mRNA degradation factors
   Exosome components
    Core exosome
     4336421
SSDB
Motif
Pfam: KH_6 ECR1_N
Other DBs
NCBI-GeneID: 4336421
NCBI-ProteinID: XP_015633681
UniProt: Q7XUA1 A0A0P0WCP7
LinkDB
Position
4:complement(26036824..26041438)
AA seq 315 aa
MRDLQLSLNQTQRVRLEAALHELQTVAPAAAVTVADTIPVNDEDNILKGHGTSDQDGEVV
ATLCGVVERVNKLVYVRTLRARYKPEVGDIIVGRVIEIAPKRWRLEINFSQDAVLMLSSM
NLPDGIQRRRTAVDELNMRTIFEENDVICAEVRGFQHDGSLHLQARSQKYGKLERGQLLV
VPAYLVKRRKQHFHHLEQYDVDLILGCNGFIWVGEHVVVGENANMMENKLNLSAEVENFT
PLETRKHICRLANAVRVLSALGFTLTVELIIETAEASVSSNIEINNMLGAEFYVQTAERE
VKRRADLLRKKSGAR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagggacctccagctctcgctgaaccagacccagagggtgcgcctcgaggccgcgctc
cacgagctccagaccgtcgcccccgccgccgccgtcaccgtcgcggacaccatccccgtc
aacgacgaggacaacattctcaaggggcatgggacgtcggatcaggacggggaggtggtg
gcgacgctgtgcggcgtggtggagcgggtcaacaagctggtgtacgtgcggacgcttagg
gcgaggtataagccggaggttggtgatatcatagttggccgtgttattgagattgcacct
aaacgctggaggttggagataaattttagccaagatgctgttttgatgctttcttctatg
aatttacccgatggaattcagagaaggagaactgctgtcgatgaacttaatatgcggaca
atttttgaagaaaatgatgttatctgtgctgaagttcgtggtttccaacatgatggatct
ctgcacctacaagcacggagtcaaaagtatggaaagcttgagaggggtcaactgcttgta
gtacctgcatacttggtaaaacgacggaagcagcatttccaccacctcgagcaatatgat
gttgacttgattcttggttgcaatggattcatctgggtaggtgagcatgttgtggtaggt
gaaaacgctaatatgatggaaaataagctgaatttgagtgctgaagtggagaatttcact
ccactagaaacaaggaaacatatttgccggcttgccaatgctgtacgtgtgctttcagct
ctgggtttcactttgacagttgaactgataattgagactgctgaagcaagtgtatcatca
aatatcgagataaacaacatgcttggggctgaattttatgtccagacagcagagagagag
gtaaaacgtcgagctgatctgttgcgaaagaaaagtggagcaagataa

DBGET integrated database retrieval system