KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336482
Entry
4336482           CDS       T01015                                 
Name
(RefSeq) syntaxin-81
  KO
K08492  syntaxin 18
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4336482
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4336482
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4336482
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-rER
    4336482
SSDB
Motif
Pfam: Syntaxin-18_N SNARE
Other DBs
NCBI-GeneID: 4336482
NCBI-ProteinID: XP_015635852
UniProt: A0A0P0WCV2 Q7X7I8
LinkDB
Position
4:26528426..26531663
AA seq 316 aa
MSRVRDRTEDFKESVRVAALGHGYTESQLAVLMSSFIIRKPAPKLPFTKAAIKTLESIRE
LEKFIVKHRKDYVDLHRTTEQERDNIEHEVSVFVKACKEQIDILKNRIHEEKGGSTKTWL
GTSDESSRLDLIAHQHGVVLILSERLHSVTVQFDRLRTMRFQDAINRAMPRKRIQKKRET
KAAEPSKPNLVLKSDVSKVEDQEVSTAPLRVQEQLLDDETRALQVELTNLLDAVQETETK
MIEMSALNHLMSTHVLQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRNSSSRTFLLLF
FFVLTFSVLFLDWYSK
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtcgagggttcgcgacaggaccgaggacttcaaggagtccgtccgcgtcgccgcgctc
ggccatgggtacacggagtctcagttagccgtgctcatgtcttccttcatcatccggaag
ccggcccccaaattaccctttacaaaggctgcaatcaagacgcttgagagtatcagggaa
ctggagaagtttattgtgaagcataggaaggactatgttgacttgcatcgcaccacggag
caagaaagggacaacattgagcatgaggtcagtgtttttgtaaaagcatgcaaggaacaa
atagatatcctaaagaacaggatccatgaagaaaaaggtggaagtacaaagacatggctt
ggtacaagcgatgagagctcccggttggatttgatagctcaccagcatggcgtggttttg
attttgagtgagcgtcttcactcagtaactgtgcaatttgatcgtcttcggaccatgcgt
tttcaagatgctattaacagagcgatgccaagaaaacggattcagaagaaacgagaaacc
aaagctgctgaaccatctaagccaaaccttgtattaaaatctgatgtttcaaaggttgaa
gatcaggaggtctctactgcaccactaagagttcaagaacaactcttggatgatgaaaca
agagctcttcaggtggagttgacaaatcttcttgatgctgtccaagaaacagagacaaag
atgatagagatgtcagcacttaatcatctcatgtcaacacatgttctacaacaagctcag
cagatccagtatttatatgaccaggcagttgaagctacaaacaatgtggagcgtgggaac
aaggagctatcccaggcgatccagcgcaacagcagcagtagaaccttcctcctacttttc
ttctttgttcttaccttttccgttctctttctggattggtacagcaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351534
Entry
4351534           CDS       T01015                                 
Name
(RefSeq) syntaxin-81 isoform X1
  KO
K08492  syntaxin 18
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4351534
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4351534
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4351534
Membrane trafficking [BR:osa04131]
 SNARE
  Syntaxin (Qa)
   Stx-rER
    4351534
SSDB
Motif
Pfam: Syntaxin-18_N SNARE
Other DBs
NCBI-GeneID: 4351534
NCBI-ProteinID: XP_015620666
UniProt: B9GBY2 A0A8J8Y7I7
LinkDB
Position
12:2678046..2681533
AA seq 316 aa
MSRVRDRAEDFKESVRVAALGHGYTESQLAALMSSFIIRKPPPKLPFTKAAIKTLESIRE
LEKFIVKHRKDYVDMHRTTEQERDNIEHEVSVFVKACKEQIDILKNRIHEEKGGSTKTWL
GTSDESSRLDLIAHQHGVVLILSERLHSVTAQFDRLRTMRFQDAINRAMPRKRIQKKRET
KAAEPSKPNLVLKSDVSKVEDQEVSTAPLRVQEQLLDDETRALQVELTNLLDAVQETETK
MIEMSALNHLMSTHVLQQAQQIQYLYDQAVEATNNVERGNKELSQAIQRNSSSRTFLLLF
FFVLTFSVLFLDWYSK
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtcgagggttcgcgacagggccgaggacttcaaggagtccgtccgcgtcgccgcgctc
ggccatgggtacacggagtctcagttagccgcgctcatgtcttctttcatcatccggaag
ccgccccccaaattaccctttacaaaggctgcaatcaagacgcttgagagtatcagggaa
ctggagaagtttattgtgaagcataggaaggactatgttgacatgcatcgcaccacggag
caagaaagggacaacattgagcatgaggtcagtgtttttgtaaaagcatgcaaggaacaa
atagatatcctaaagaacaggatccatgaagaaaaaggtggaagtacaaagacatggctt
ggtacaagcgatgagagctcccggttggatttgatagctcaccagcatggtgtggttttg
attttgagtgagcgtcttcactcagtaactgcacaatttgatcgtcttcggaccatgcgt
tttcaagatgctattaacagagcgatgccaagaaaacggattcagaagaaacgagaaacc
aaagctgctgaaccatctaagccaaaccttgtattaaaatctgatgtttcaaaggttgaa
gatcaggaggtctctactgcaccactaagagttcaagaacaactcttggatgatgaaaca
agagctcttcaggtggagttgacaaatcttcttgatgctgtccaagaaacagagacaaag
atgatagagatgtcagcacttaatcatctcatgtcaacacatgttctacaacaagctcag
cagatacagtatttatatgaccaggcagttgaagctacaaacaatgtggagcgtgggaac
aaggagctatcccaggcgatccagcgcaacagcagcagtagaaccttcctcctgcttttc
ttctttgttcttaccttttccgtcctctttctggattggtacagcaaatga

DBGET integrated database retrieval system