KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336637
Entry
4336637           CDS       T01015                                 
Name
(RefSeq) acyl-coenzyme A thioesterase 8 isoform X1
  KO
K01068  acyl-coenzyme A thioesterase 1/2/4 [EC:3.1.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00062  Fatty acid elongation
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    4336637
   01040 Biosynthesis of unsaturated fatty acids
    4336637
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4336637
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     4336637
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4336637
SSDB
Motif
Pfam: 4HBT_3 Acyl_CoA_thio cNMP_binding
Other DBs
NCBI-GeneID: 4336637
NCBI-ProteinID: XP_015637047
UniProt: Q7XPS0
LinkDB
Position
4:27984099..27990559
AA seq 453 aa
MDREEGKAAQSPPNLGALLANPRGGCHWCAVTEFLGQVPLLQCLPSSSIRRIADAVLVKR
YEPGGYVAREGDPVDGLYIILDGQAEVSAPANTEEENRPDYVLNKYDYFGYGTNSSVHQV
NVIAVSKLTCFVLPNQYGHLLQPKTIWSAEETPENHSLLEQILHLEPLEVDIFRGFTLPG
APTFRQVFGGQLIGQALAAASKTVDCLKAVHSLHAIFLIAGDKNLPIIYQVHRARDGTSF
ATRKVEAKQKGLVIFTLIASFQKDELGFEHQAAIMPDVPPPEELLNLEEIRERRLTDPRF
PMQYRNSAAKKKFVPWPIEMRFCEDSASQHKPSLNYWFRARGKLSDDPALHRCVVAYASD
LLYSGVSLNPHREKGLKTYSLSLDHSIWFHKPVKADDWLLYVIDSPSAHGGRGFVTGRMF
NRQGELVMSLTQEALIRRAKTPGQPSQTPRPKL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggatcgggaagaaggtaaagcagcgcagagcccgccgaatttaggagcgctcctggct
aatccgaggggtggttgccattggtgtgcagtgacggagttcctcggccaggtgcccctc
ctgcagtgcctccccagctcctccatccgcaggatcgccgacgccgtcctggtgaagcgc
tacgaacctggtggttacgttgctcgtgaaggtgaccctgtagatggcctttacatcata
ttggatgggcaggctgaggtttcagctcctgcaaacacagaagaagaaaaccgccctgac
tatgtgttaaataagtatgactactttggttatggaaccaatagttctgtgcatcaagta
aatgttattgcagtatcaaagctgacctgcttcgtattgccaaatcaatatggacacttg
ttgcaaccaaagaccatttggagtgcagaagagacacctgagaaccattctttgctagaa
caaattttgcacttagagccattggaggtcgatatcttccgtgggtttactttgccagga
gctccgacttttaggcaagtttttggaggacagttgataggacaggcactagcagcagca
tccaagaccgttgactgcctaaaagcggtgcacagtttgcacgcaattttccttatcgca
ggagacaagaatttgccaataatatatcaggttcatcgggcgcgcgatggaacaagcttt
gccaccagaaaagtggaggcaaagcaaaagggccttgtcattttcaccttgattgcttca
ttccagaaagacgaattagggtttgagcatcaagctgcaatcatgcctgatgttcctcct
ccagaagagctcctgaatctggaagagatacgggaaagaagacttactgatcctcgcttc
ccaatgcaatataggaactcagctgccaagaaaaagttcgtaccttggcccatagaaatg
aggttttgtgaagattcagcatctcaacataaaccaagcttaaattattggtttagagcc
agaggaaaactttctgatgatccagcactgcataggtgtgttgtagcatatgcttcggat
ctactatattctggtgtcagcctaaatcctcatagggagaagggtctgaagacatactca
ctcagtcttgatcactcgatttggttccacaagcctgtgaaagctgatgattggctttta
tatgtgatcgacagcccatctgcacacggtgggcggggttttgttacagggcgaatgttc
aaccgacaaggagagctcgtcatgtcgttgacccaagaggcgctgattaggagggcgaag
acgccaggacaaccgtcacaaaccccaaggccaaagctttga

DBGET integrated database retrieval system