KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336807
Entry
4336807           CDS       T01015                                 
Name
(RefSeq) DNA replication ATP-dependent helicase/nuclease DNA2
  KO
K10742  DNA replication ATP-dependent helicase/nuclease Dna2 [EC:5.6.2.3 3.1.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4336807
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4336807
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     4336807
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4336807
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    4336807
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     4336807
SSDB
Motif
Pfam: Dna2 AAA_12 AAA_11 AAA_30 AAA_19 PDDEXK_1 UvrD-helicase Cas_Cas4 Helicase_RecD PhoH ResIII
Other DBs
NCBI-GeneID: 4336807
NCBI-ProteinID: XP_015634569
LinkDB
Position
4:29719374..29730119
AA seq 1281 aa
MLRRSLRPRSRRSRPSSAFSTSSSASPRPPPRTPSARRPTAPRSLPLPTYLPPPPPPLIE
EEPSEVSPEVTKTLAPKRVRFSPGMLIKQSQDDGGGEVVTWKISPVNDRLRMVTSRQMTG
MALHPCSNNEKHSSVESTKKWHSSLLGMSRCTASARNLDMCGTGPGGCDGVEDTQSPFRT
PPSLSYRCSEQLNGGVVSDGGPEQLGAGEHKKALLDLLDQVEDAIMEEELPADGENKGEQ
LINGDPKNISCSPIADSDQNVPSQKSLDAPPFDSFLVLEVSEKHKGDNLPCDRYPVKVLR
LLNEHGGKEHAVHLCDEWFHSLISPGDTVSVIGEFTDHGICIIDHDKNLVIVHPELLISG
TRVASSFHCPRRSVLDDRLKSNEYSTSALIGTLLHQVFQAGLLEDVPSTQFLEQQAKEVL
LKNIESLYACGASESNTLKTLIEAVPKILNWYKCFMKVSKCNNVNFGQIEGQKTVGVVEV
MDIEEMAWAPRYGLKGIIDASIRSRVSCNGSSYDRVMPLEFKTGKGTSGQTAVEHTAQVI
LYTLLMTERYLNKDIDLGLLYYLHTDQTLGIKVKRSDLIGLIMRRNELATEILKASISQS
FPPMIQSPSTCNGCRHLVSCTIYHKAHGGNAATSGLGDLFDNLVNHLTVAHHTFLKHWDR
LIDLEARVSQVKKKEIFQPHHSNTGSRHSSPSYFVLDVTNGHSIDSSGKSKRYIYTFLRQ
KLQPETADQPGEHVESVDFSLKCGDSVVLSTKSGRIAVANGYIRDLSRAHITVSLPRRLR
LPGSNSLLEQGDLQCEVWRIDKDESVSSFATMRLNLVQLFAENPQNSHLRKLIVDLEAPR
FDSGGLLSQDPALSYIQSLPNLNNDQQRSLHKILAAKDYALILGMPGTGKTYTMVHAVKS
LLMRGESILLTSYTNSAIDNLLMKLKAEGVDFLRIGRHEAVHPDVKGHCLSTTDIQSVDA
VKARMEQVQVVGVTCLGIYHPLLAHKKFDTCIMDEAGQITLPVSLGPLMLATKFVLVGDH
YQLPPLVQSSEARENGMGVSLFWRLSEAHPQAISALRCQYRMSSGIMELSNSLIYGNRLS
CGSLEIANAKLKLSGRGPVRLKLKEILNPDRAVVFANTDEVPAFEAKEHRTVNNPTEALI
VSWITNELLKRGVAQDGVGIITPYNAQANLIQQHVDASVEVHTIDKYQGRDKECIIVSFV
RSNGNTRASGSSLLGDWHRINVVLTRAKKKLIMVGSAATLSTIPLLRLMIEKVAERGGQL
DLTNKDVQSIRELTSSRLNVQ
NT seq 3846 nt   +upstreamnt  +downstreamnt
atgcttcgaagaagcctgcggcctcgcagccgtcgcagccggccaagttcggcattctcc
acttcttcgagcgccagtcccaggcctcctcccagaacgccaagcgccagaaggccgacg
gcccctcgcagcctcccgctgcctacctacctgcctccgccgccaccgccgctcatcgag
gaggagccatcggaggtgtcgccggaggtcaccaagactctggcgccgaagcgggtcagg
ttttctcctgggatgctgattaagcagagccaggacgatgggggtggggaggttgtgact
tggaagatctcgccggtgaatgatcgcctgcgcatggtcacttcaaggcagatgactggt
atggcgcttcatccgtgctcaaacaatgagaagcattcctcggtcgagtctacaaagaaa
tggcattcatcactgctgggcatgtcaagatgtactgcttcagcacgcaatttggatatg
tgtggaactggtccaggtggctgtgacggtgtggaggacacccaaagcccatttcggact
cctccatcactgtcctataggtgcagtgagcagcttaatgggggtgtggtttctgatgga
ggacctgagcagttgggggcaggggagcacaaaaaggcactacttgatcttttagatcaa
gtggaagatgcaatcatggaagaagaattacctgctgatggtgagaataaaggagagcag
ctcataaatggtgatccgaaaaacattagttgttctcctattgctgacagcgatcaaaat
gtaccctcccagaagtcccttgatgccccgcccttcgatagctttttggtgttggaggtg
tcagaaaagcacaaaggcgataacttaccatgtgatcgctatcctgttaaggttttacgt
ttgctgaatgagcacggtgggaaagagcatgcagtccatttgtgtgatgagtggttccat
agccttattagcccaggcgacacagtaagtgtcattggagaattcactgaccatggaata
tgtattattgatcatgacaaaaatcttgttatagtgcatccagaattactcatatctgga
acacgggttgcttctagttttcattgtccaagaaggtctgttctcgatgacagactaaaa
agcaatgaatattcaacaagtgctttgattggtactctgctgcatcaagtattccaggca
gggctacttgaagatgttccttcaacgcaattcttagagcagcaagccaaagaagttctt
ttgaaaaatattgagagtttatatgcatgtggagccagtgaaagcaacacgcttaaaacg
ctgattgaagcagtccccaaaatattgaattggtacaagtgctttatgaaggtatcaaaa
tgtaacaatgtaaattttggtcaaattgaaggacaaaagactgttggagttgtggaggta
atggatattgaggagatggcctgggctccaagatatggtttgaaagggattattgatgct
tctattagatcaagggtttcatgcaatggtagttcatacgacagagtaatgcctctggag
ttcaaaactggtaaaggaactagtggtcagacagctgtggaacacactgcccaagtgata
ttgtacacgctattgatgacggagagatacttgaacaaggatattgacttgggtcttctg
tattatcttcacacagaccaaacattgggcatcaaagtcaagaggtctgatttaattgga
ttaataatgcgtcggaatgagcttgccactgagatcctgaaggcatcgatttcacagagt
tttcccccgatgatacagagtccatctacatgtaatggatgtcgacacctggtttcatgc
accatataccacaaggcgcatggaggcaatgctgcaactagtgggcttggtgatttattt
gataatctcgtgaatcacttgacagttgcacatcatacctttcttaaacactgggacaga
ttgatcgatcttgaagctagagtttctcaggtcaagaagaaggaaattttccagccacat
cattcaaatactgggagcaggcattcttccccatcttattttgtccttgatgttacaaat
ggacattcaatagattcatctggaaaaagcaaaagatacatatatacttttctgcgccag
aagttgcagcctgagacagctgatcagccaggagaacatgttgaaagtgtagattttagc
ctcaaatgcggtgattctgtggtgcttagcacaaaatctgggcgaatagctgttgcaaat
ggatacataagggacctcagccgtgcccatataacggtttcattgccacgacgtctgaga
cttccaggaagtaattccttgttagagcaaggagatctccaatgtgaagtttggcgtata
gataaggatgagtctgtttcttcatttgctaccatgagactcaaccttgtccaactattt
gctgagaatccacaaaactctcacctaaggaagttgattgttgacctcgaggctcccaga
tttgatagtggaggactcctaagtcaagatccggcactatcatatatacaatcattgcca
aatttgaacaatgaccaacagagatcgctgcataaaattctagcagcaaaagattatgcg
cttatcctaggaatgcctggaacaggcaaaacatatacgatggtgcatgccgtgaagtca
ttattgatgagaggggaatctattttgctaacctcatataccaattcagctatagataat
ttgcttatgaagttgaaggctgagggtgtagattttcttcgaattggaaggcatgaagct
gtacatcctgatgtcaaaggccactgcttgtcaacaacagatatacaatcagtagatgcc
gtcaaagctagaatggagcaagtgcaagttgttggagtcacttgtttgggaatttatcac
cctttactagcacataagaagtttgacacatgtatcatggatgaggcaggccagatcaca
ttaccggtatctctgggacctttgatgcttgcaacaaagtttgttctagtaggagatcat
tatcagcttcctccacttgttcagagttctgaagctcgagagaatggtatgggtgtcagt
ttattttggaggttgtcagaagcacaccctcaagcaatttcagcattgcgatgccagtac
cgaatgtcatctggcattatggagctctcaaattcattgatttacggcaataggttatcc
tgtggttcgttggaaattgcaaatgccaaactcaagctttctggcagaggtcctgttcgc
ttgaagctgaaagagatcttgaaccctgatagggctgtcgtctttgcgaacacagatgaa
gtaccagcttttgaggccaaggaacatagaactgtgaacaatcctacagaagcattaatt
gtttcatggatcaccaatgaattgctaaagagaggtgtagctcaagatggggttggtata
ataactccatataatgcccaagcaaatctcattcagcaacatgtagacgcttcagttgag
gttcatacaattgacaagtaccaggggagggataaagaatgcattatagtatcttttgta
cggtccaacgggaatacaagggctagtggttcttctttgcttggtgattggcacaggatc
aacgttgtcttgacacgtgcaaagaagaagctcatcatggtgggatccgctgcaactctt
tcaacgatcccattgttgagacttatgattgagaaggtagctgagcgtggcggtcagtta
gatctgacaaataaggatgtacagtcaattcgagagctaacaagctctcgattgaatgta
caatag

DBGET integrated database retrieval system