KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336813
Entry
4336813           CDS       T01015                                 
Name
(RefSeq) alpha-1,3/1,6-mannosyltransferase ALG2
  KO
K03843  alpha-1,3/alpha-1,6-mannosyltransferase [EC:2.4.1.132 2.4.1.257]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4336813
   00513 Various types of N-glycan biosynthesis
    4336813
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4336813
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.132  GDP-Man:Man1GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     4336813
    2.4.1.257  GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     4336813
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4336813
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_2
Other DBs
NCBI-GeneID: 4336813
NCBI-ProteinID: XP_015635731
UniProt: Q7XLZ9 A3AWW3
LinkDB
Position
4:29803042..29805994
AA seq 418 aa
MAAAAGGVAGEPSGTRTKQLKVAVIHPDLGIGGAERLIVDAACQLAVHGHDVHVFTSHHD
KNRCFEETVSGPFEVKVYGDFLPRHIFYRFHAICAYLRCIFVAMCVLLWWPSFDIILVDQ
VSVVIPLLKLKAKSKIVFYCHFPDMLLAQHTTMLRRLYRKPIDMIEETTTGMADLILVNS
KFTATTFARTFCSLHARGVEPAVLYPAVSVEQFQEPHAYKLNFLSINRFERKKNLGLAIS
AFSLLRSVASMLPGDARQEVTLTVAGGYDKRLRENVEYLEELKRLAASEGVSEHVKFVTS
CSTSERNELLSNCLCVLYTPKDEHFGIVPLEAMAAYKPVIACNSGGPVETVINDETGFLC
EPSAPEFSKAMLKLVNDHDLAVKMGKQARGHVVQKFSTKTFGDLLNSYVLNVYHQRIE
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcagcggcggcgggaggagtcgccggcgagccgtcggggacgaggacgaagcagctt
aaggtcgccgtgatccaccccgatctcgggataggtggtgctgagagattgatagtcgat
gcggcttgtcagcttgcggtccatggtcatgatgttcatgttttcacatcacatcatgac
aaaaaccgatgctttgaagagactgtttctggtccatttgaagttaaagtatatggagat
ttcttgcctcgccatattttttaccgcttccacgctatctgtgcatatcttcgctgcatt
tttgttgcaatgtgtgtgctactttggtggccctcatttgacatcatattagtagaccag
gtttcggttgtgattccactgcttaaactgaaggcaaaatccaagatagtattttattgt
cactttcctgatatgttgcttgctcaacatactaccatgcttcggaggttgtatcgcaag
ccaattgacatgattgaagaaacaactactggtatggcagatttgattctagtaaacagc
aagttcactgcaacaacatttgccaggaccttttgcagccttcatgctagaggagtcgag
cctgctgttctatatccagctgtctctgttgaacagtttcaggaacctcatgcttataag
ttgaatttcctctcaattaaccggtttgagagaaaaaagaatcttggtcttgccatttca
gcattttctctgcttcgctctgttgcttctatgctacctggtgatgctcgacaggaagta
accttaacagtagcaggtggatatgataagcgtctcagagaaaatgttgaataccttgag
gagctcaaaagattggcagcgagtgaaggggtttctgaacatgtcaaatttgtgacatct
tgttcaacttctgaaaggaacgaacttctctccaactgcctttgtgtgttatacactcca
aaggatgaacatttcggtattgttcctctggaagccatggccgcatataaacctgtaatt
gcatgcaacagtggtggtccagtggaaacagtcataaatgacgagacagggtttctctgt
gagccctctgcccctgaattttcaaaagccatgctgaagctcgtgaacgatcacgatcta
gcagttaagatgggtaaacaagcaaggggccatgttgtgcagaagttctcaaccaagaca
tttggtgaccttctgaacagctatgtccttaatgtgtaccatcagaggattgagtga

DBGET integrated database retrieval system