KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336951
Entry
4336951           CDS       T01015                                 
Name
(RefSeq) oxygen-dependent coproporphyrinogen-III oxidase, chloroplastic
  KO
K00228  coproporphyrinogen III oxidase [EC:1.3.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4336951
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.3  coproporphyrinogen oxidase
     4336951
SSDB
Motif
Pfam: Coprogen_oxidas
Other DBs
NCBI-GeneID: 4336951
NCBI-ProteinID: XP_015633531
UniProt: Q7XPL2
LinkDB
Position
4:30961588..30965407
AA seq 399 aa
MAPSLLTTPSQALALAPGAAASRVGGGGGGSARVSFPSGRVQRRGALGMRVRASVAIEKE
TPESEPPPTFLREDGSGAGSGSVRERFEAMIRRVQGEVCAALEEADGSGARFVEDVWSRP
GGGGGISRVLQDGRVFEKAGVNVSVVYGVMPPDAYRAAKGEAGKNGAAADGPKAGPVPFF
AAGISSVLHPKNPFAPTLHFNYRYFETDAPKDAPGAPRQWWFGGGTDLTPSYIIEEDVKH
FHSVQKQACDKFDPSFYPRFKKWCDDYFYIKHRNERRGLGGIFFDDLNDYDQEMLLNFAT
ECADSVVPAYIPIIERRKDTPFTEEHKAWQQLRRGRYVEFNLVYDRGTTFGLKTGGRIES
ILVSLPLTARWQYDHTPEEGTEERKLLDACINPKEWLDL
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcgccctctctcctcaccaccccgtcccaggccctggccctcgcccccggcgccgcc
gccagccgcgtcggcggcggcggcggcgggtcggcgcgggtgagcttcccgtccggccgc
gtccagcgccgaggcgcgctggggatgcgggtgcgggcgtcggtggcgatcgagaaggag
acgcccgagagcgagccgccgccgacgttcctgcgggaggacgggtccggggcggggtcc
gggtcggtgcgggagcggttcgaggccatgatccgccgcgtgcagggggaggtgtgcgcg
gcgctggaggaggccgacgggagcggcgcccggttcgtggaggacgtgtggtcgcgcccc
ggcggcggcgggggcatcagccgggtgctccaggacggccgcgtgttcgagaaggccggg
gtcaacgtctccgtcgtgtacggcgtcatgccccccgacgcgtaccgcgccgccaagggg
gaggccggcaagaacggcgcggcggcagatggccccaaggctgggcccgtgcccttcttt
gccgctggcattagctcggttcttcaccccaagaacccatttgctccaacattgcatttt
aactaccgctattttgagacagatgcaccgaaagatgctcctggtgcaccaaggcaatgg
tggtttggaggtggtactgatttgactccttcatatatcattgaagaggatgtgaagcat
ttccattctgttcaaaaacaagcgtgtgataagtttgacccaagtttttacccgagattc
aaaaaatggtgtgatgattatttctatattaagcaccgtaatgagcgtcgggggcttggt
ggaatattttttgatgatcttaatgactatgatcaagaaatgcttctcaactttgctaca
gaatgtgcggattctgttgttcctgcatacataccaatcattgaacgccggaaggacact
ccatttactgaggaacacaaggcatggcaacaactgaggagaggtcgctatgtggagttc
aaccttgtatatgatcgcggtaccacatttggcctcaagactggggggaggattgagagt
attctggtttctcttccactgactgcacgatggcagtatgatcatacacctgaagaggga
actgaagaacggaaacttcttgacgcgtgcataaacccaaaggaatggctcgatctctga

DBGET integrated database retrieval system