KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337006
Entry
4337006           CDS       T01015                                 
Name
(RefSeq) peroxisome biogenesis protein 6
  KO
K13339  peroxin-6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4337006
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337006
Membrane trafficking [BR:osa04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    4337006
SSDB
Motif
Pfam: AAA AAA_16 AAA_5 AAA_lid_3 RuvB_N AAA_22 RNA_helicase AAA_18 AAA_7 AAA_17 Rad17 DUF815 TsaE AAA_33 AAA_28 AAA_25 ATPase_2 Cytidylate_kin Parvo_NS1 AAA_14 AAA_24 Mg_chelatase TIP49 AAA_2 AAA_6 Sigma54_activat IstB_IS21 PhoH AAA_3 ATPase preSET_CXC
Other DBs
NCBI-GeneID: 4337006
NCBI-ProteinID: XP_015634963
UniProt: Q0JA37
LinkDB
Position
4:complement(31364056..31369481)
AA seq 940 aa
MVEATRQRRKPLVLASTQALLDSLPGDRRGSALPPPPPPEPVRIRAGVLRFPNSSSSSSS
AGGGEFGEAASFVALPSSALRRLAVVTGTPVLVKNADNNVGRIAKAVVLDHPCLDDSLTE
HTEPVDAASPLDNAMGILPCRSFPTNGFPPLDEEVAYVSPLLAFNLGVHVSCLKLLVQKG
EKPFKFCSKVEDSDLAAGEESNPILHLEILPSPQVPKHALHLRVSVVRIPECGVFASLKA
NSAIGGSDYQDMIDQALNEHFKFDRFLARGDVFCIRNNWNCGATSCLACNREDNRLHPHD
MIYFKVTGMEPSDEPVHRVNCNQTALVLGGGASASIPPYSLFASPGASVPLHSEIVEHLA
SIIAPALCPSNILPKVKFSTFLYGPSGCGKRTVVKHVANHFGLHVVECSCHDLMTSSDSG
APAALVAAFKEAHKYSPCIILLRHFDAIGNTSSNEGTQSAQSGTAANIESVIKQYIGQHW
VATESLPARDINGNPYLVEPECVSPLQVILVATADRAEGMPQSIRRCFRHEINMKSINEE
QRRNLISETLHCVSTSADESINDKFVKDLAVQTSGFMPRDILALVADAGISFAHKVETDK
NNSEGDKLKGILPTSSSSSQNEEKTFCKEYILSSLERAKKRNRAALGTPKVPNVKWEDVG
GLEEVKKVILDTIQLPLLYKHLFSSKLGKRSGVLLYGPPGTGKTLLAKAVATECSLNFLS
VKGPELINMYVGESEKNVRDIFEKARSARPCVIFFDELDSLAPARGSSSDSAGVMDRVVS
QLLVEIDGLSDNSQDLFIIGATNRPDLLDSALLRPGRFDKLLYVGVNSDASYRERILKAQ
TRKYKLHENVSLLSIAQQCPPNFTGADIYALCADAWYHAAKNLAKTLEADPSRTSEASAD
DVIVEINDFMTVLGDITPSLSIEELQNYEQLRKKIEGPSR
NT seq 2823 nt   +upstreamnt  +downstreamnt
atggtggaggcgacgcggcagcggaggaagccgctggtgctggcctccacgcaggcgctg
ctcgactcgctgccgggggaccgccgcgggtcggcccttccgccgccgccgccgccggag
ccggtgcgcatcagggccggggtgctccgcttccccaactcctcctcctcctcgtcttcc
gcgggcggaggcgagttcggggaggccgcctccttcgtcgccctcccctcgtccgcgctc
cgccggctcgccgtcgtcaccggcacgccggtgcttgtgaagaatgctgacaataatgtc
ggaaggattgccaaagcagtagtacttgatcacccatgccttgatgattccctgacagaa
catactgagcctgtggacgcagcctctcccttggataatgccatgggtatcttaccctgt
cgctcttttccaacaaacggctttccgcccttggatgaagaggtcgcttatgttagccca
cttctggcattcaatctgggagtccatgtctcttgtctcaagcttcttgttcaaaaagga
gagaaacctttcaagttctgttctaaagttgaagatagtgatctggctgctggtgaagaa
agtaatcctattcttcacttagagattcttccatcccctcaagtgccgaaacatgctttg
catttgcgggtttctgttgtgaggattcctgaatgtggtgtgtttgcttctctaaaggca
aattcagccattggaggaagtgactaccaagatatgattgatcaagctctgaatgagcac
tttaagtttgataggttcctagcgagaggggatgttttttgcataaggaacaattggaat
tgtggcgcaacctcctgccttgcatgcaacagggaggacaatagactccatcctcatgat
atgatttacttcaaggtgactggcatggaaccatcagatgaaccagttcatcgcgtcaac
tgtaatcaaacagcccttgttcttgggggaggtgcttctgcttcaatacccccttacagt
ttgtttgcttctcctggtgcttcagttcctttgcacagtgaaatagtggagcatttagca
tctatcattgcaccagcactatgtccttcaaacattttgccaaaagtcaagttttccact
ttcttatacgggccttcaggatgtgggaagcggacggtagtcaagcatgttgccaaccat
tttggtttgcatgtggttgagtgtagctgtcatgatctaatgacttcatcagatagcggg
gcaccagctgcacttgtggctgccttcaaagaagctcataagtattcaccatgtataata
cttcttcgccactttgatgctattgggaatacatcctccaacgaagggacacaatctgcg
caatctggcactgcagcaaacattgaatccgtcatcaagcagtacattggacaacattgg
gttgctacggaatcgctcccagcaagagatataaatggaaatccataccttgtggaacct
gaatgtgtaagcccacttcaagttatactagttgcaactgcagatcgtgctgaaggaatg
ccacaatcaattaggcgatgtttccgccatgagataaacatgaaaagtataaatgaagaa
cagaggaggaacttgatatctgaaacactccattgtgtttcaacgtcagctgatgagagt
ataaatgacaagttcgtaaaagatttagcagtacaaacgtctggtttcatgccaagggat
atacttgcattggttgcagatgctggcatatcttttgcacataaagttgaaacggataaa
aataatagcgaaggtgataagcttaaaggcatccttcctacaagctcttctagctctcaa
aatgaagaaaaaactttttgcaaagaatatattttgtcttctctagaacgggccaagaaa
aggaatcgtgctgcactgggtacacccaaagttcctaatgtcaaatgggaggacgttggt
ggtcttgaggaagtgaaaaaggttattctagatactattcagttacctctgttgtataag
caccttttttcttctaaattggggaagcggtcaggtgtcctgttgtatggacctcctggc
acagggaagacattattggcaaaagctgtagcaacagagtgctctttaaactttcttagt
gtaaaaggtccagaattgattaacatgtatgttggagaatcggagaagaatgtaagggac
atttttgagaaggcaagatctgcacggccatgtgtaattttctttgatgagcttgattcc
cttgctcctgcacgaggatcctcctcagattccgcaggtgtgatggatagagtagtttca
cagttgcttgtggagattgatgggttaagcgataacagtcaggatcttttcattattgga
gctacaaataggcctgaccttcttgattctgcacttctccggcctggccgctttgataag
cttctctatgttggtgtaaattcagatgcatcatatagagaaaggatcctgaaagcacag
acacgcaagtataagctccatgagaatgtttctctcttgtcaattgctcagcaatgtcct
ccaaactttaccggtgctgatatttatgcgttatgcgcagacgcatggtatcatgctgct
aagaacttggccaaaacacttgaggctgatccttcaagaaccagtgaagccagtgctgat
gacgtcattgttgagataaatgatttcatgacagtgttaggggatatcacaccatcgttg
tctatagaagaattacaaaactatgaacagttgaggaagaagattgagggaccatctaga
tga

DBGET integrated database retrieval system