KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337050
Entry
4337050           CDS       T01015                                 
Name
(RefSeq) signal recognition particle 14 kDa protein isoform X1
  KO
K03104  signal recognition particle subunit SRP14
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4337050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4337050
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4337050
SSDB
Motif
Pfam: SRP14 DUF3105
Other DBs
NCBI-GeneID: 4337050
NCBI-ProteinID: XP_015635504
UniProt: O04433
LinkDB
Position
4:31696183..31700125
AA seq 132 aa
MVVLQPDPFLSELTSMYERSTEKGSVWVTMKRSSMKCQARLKKMAAKGEAVEYRCLVRAT
DGKKNICTALSAKEYLKFQASYATVLKAHMHALKKRERKDKKKAAEVEKIPEKAPKKQKK
APSSKKSAGSKS
NT seq 399 nt   +upstreamnt  +downstreamnt
atggtggtgctgcaaccagatccgtttctgagcgagttgacgagcatgtacgagcggagc
acggagaagggatctgtctgggtcaccatgaagcgatcatcgatgaagtgccaggcaagg
ttgaagaagatggcggcgaagggagaggcagtggagtaccggtgcctcgtccgtgccacc
gatggcaagaagaacatctgcaccgcgctctctgcaaaggagtacctgaagttccaagct
tcatatgccacagttcttaaagcccatatgcacgctttgaagaagagggagaggaaagac
aagaagaaggctgcagaggttgagaagataccagagaaggcaccgaagaagcagaagaaa
gcaccgtcttcaaagaaatctgcagggtccaagtcgtaa

DBGET integrated database retrieval system