KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337137
Entry
4337137           CDS       T01015                                 
Name
(RefSeq) double-strand break repair protein MRE11
  KO
K10865  double-strand break repair protein MRE11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4337137
   03450 Non-homologous end-joining
    4337137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4337137
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337137
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    4337137
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     4337137
    BRCA1-C complex
     4337137
   NHEJ (non-homologous end-joining)
    MRX complex
     4337137
SSDB
Motif
Pfam: Mre11_DNA_bind Metallophos
Other DBs
NCBI-GeneID: 4337137
NCBI-ProteinID: XP_015635669
UniProt: Q7XQR9
LinkDB
Position
4:32342566..32348421
AA seq 705 aa
MGDESNTLRVLVATDCHLGYMEKDEIRRFDSFEAFEEICSLAEQNKVDFVLLGGDLFHEN
KPSRSTLVKTIEILRRYCLNDQPVKFQVVSDQTINFPNRFGQVNYEDPNFNVGLPVFTIH
GNHDDPAGVDNLSAIDILSACNLVNYFGKMDLGGSGVGEIAVYPVLVKKGTTFVALYGLG
NIRDERLNRMFQTPHAVQWMRPETQDGMSVSDWFNILVLHQNRIKTNPKSAINEHFLPRF
LDFIVWGHEHECLIDPQEVPGMGFHITQPGSSVATSLIDGEAKPKHVLLLEIKGNQYRPT
KIPLRSVRPFHYAEVVLKDEVDVDPNDQASVLEHLDKIVRNLIKKSSQPTASRPETKLPL
IRIKVDYSGFSTINPQRFGQKYVGKVANPQDILIFSKSAKKRQTTGVGNIDDSEKLRPEE
LNQQTIEALVAENNLKMEILPVDDLDIALHDFVSKDDKMAFYACLQRNLEETRTKLNSEA
DKFKIEEEDIIVKVGECMQERVKERSLRSKEDSRFTSSSQNLDTGGRSVTAQSNLNSFSD
DEDTREMLLGARTTNAGRKASGFTRPSKDATDVAKTGTSRRGRGRGTASMKQTTLNFSQS
RSSAAIRSEEVQSSSDEENETNEANEVVESSEPEESPQQTGRKRAAPRGGRGRGRGATAK
RGRKADISSIQSMLMSKDDDDDDEDDRPKKPPPRVTRNYGAVRRR
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgggagacgaaagcaacacactccgtgtacttgtggcaaccgattgccatctcggctac
atggaaaaggacgagattcgtaggtttgattcatttgaggcgtttgaagagatatgctca
ttagcagagcagaataaggttgattttgtgctacttggtggtgaccttttccatgagaac
aaaccttcacgttcaaccttagttaagaccattgagattctacggcgttactgcttgaat
gaccagccagtgaagttccaggttgtcagtgatcagacaatcaactttccaaacagattc
ggccaagtaaattatgaagatccaaacttcaatgttggattgcctgtgttcactatccat
ggaaaccatgatgatccagctggtgtggataatctctctgcaattgatattctctcagcc
tgcaatcttgtaaattattttgggaagatggaccttggtggctctggtgttggtgaaata
gcagtctatcctgtactcgtaaaaaagggtacaacttttgttgcgctctatggccttgga
aacattagagatgaacgattaaacaggatgtttcagacacctcatgctgtacaatggatg
cgacctgaaactcaagatggaatgtcagtatctgactggttcaatattcttgttcttcat
cagaataggataaaaacaaaccctaaaagcgcaatcaatgagcatttcttaccacgtttt
ctggactttatagtatggggccatgagcatgaatgccttattgatccccaggaggtacct
gggatgggttttcacatcactcaaccaggctcatcagttgcaacctccctgattgatggt
gaagcaaaaccaaagcatgttctcttgttagaaatcaagggaaaccagtataggccaacc
aaaatacctttgagatccgttaggccctttcactatgctgaggttgtgttaaaagatgaa
gtggatgttgatcccaatgatcaggcctctgttcttgaacatttggataaaattgtaaga
aatcttattaagaagagtagtcagccaacagccagtagaccagagaccaaacttccacta
attagaatcaaggtagattactctgggttttcaacaattaatccacaacgatttggtcag
aagtatgtcgggaaggttgcaaacccccaggatattcttatcttctcaaaatcagcaaaa
aagcgtcagactactggagtaggcaatattgatgactctgagaaacttcgtcccgaggaa
ctaaaccaacaaactattgaagctttggttgccgaaaataacttgaaaatggagattctt
ccagttgatgacttggacattgcattgcatgattttgtgagcaaggatgacaagatggcg
ttttatgcctgtttgcagcggaatcttgaagaaaccagaactaaattgaattcagaggca
gataaatttaaaatagaggaagaagatataatagtcaaagttggcgagtgcatgcaggaa
cgtgtgaaggaaaggtccctccgctccaaggaagattcacggttcacgtcaagctctcaa
aacttggatactggaggtagatctgttacagctcaaagtaacctgaactctttcagtgat
gatgaagacaccagggagatgcttctcggtgcaagaacaactaatgctggaaggaaagca
tctggatttacaagaccctctaaagatgctaccgatgttgccaaaactggaacttccaga
aggggcaggggaagagggacggcctcaatgaagcagaccactctgaatttcagccaatca
aggtcaagtgctgctatccgcagtgaggaagtgcaatcttcttcagatgaggaaaatgag
actaatgaagcaaacgaagttgttgaatcttcagaaccggaggagagtccccaacaaact
ggacggaaaagggcagctcctagaggtggtagaggtaggggtagaggcgctactgcaaaa
aggggtagaaaagcagatatttcatccatccagagcatgctgatgagcaaagatgatgat
gacgatgatgaagatgacaggccgaagaaacctccacctcgggtcactaggaactacgga
gctgttaggaggagatga

DBGET integrated database retrieval system