KEGG   Oryza sativa japonica (Japanese rice): 4337137
Entry
4337137           CDS       T01015                                 
Symbol
MRE11, OsJ_16317, OsMre11
Name
(RefSeq) double-strand break repair protein MRE11
  KO
K10865  double-strand break repair protein MRE11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
osa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4337137 (MRE11)
   03450 Non-homologous end-joining
    4337137 (MRE11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4337137 (MRE11)
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337137 (MRE11)
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    4337137 (MRE11)
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     4337137 (MRE11)
    BRCA1-C complex
     4337137 (MRE11)
   NHEJ (non-homologous end-joining)
    MRX complex
     4337137 (MRE11)
SSDB
Motif
Pfam: Mre11_DNA_bind Metallophos FXMRP1_C_core PspAA
Other DBs
NCBI-GeneID: 4337137
NCBI-ProteinID: NP_001406824
LinkDB
Position
4:join(32850716..32850717,32850948..32851083,32851221..32851378,32851573..32851663,32851757..32851876,32851948..32852016,32852136..32852227,32852360..32852462,32852543..32852650,32852731..32852793,32852855..32852926,32853104..32853181,32853260..32853322,32853399..32853462,32853599..32853684,32854238..32854351,32854542..32854619,32854694..32854762,32854850..32855085,32855267..32855357,32855487..32855675,32855863..32855898)
AA seq 705 aa
MGDESNTLRVLVATDCHLGYMEKDEIRRFDSFEAFEEICSLAEQNKVDFVLLGGDLFHEN
KPSRSTLVKTIEILRRYCLNDQPVKFQVVSDQTINFPNRFGQVNYEDPNFNVGLPVFTIH
GNHDDPAGVDNLSAIDILSACNLVNYFGKMDLGGSGVGEIAVYPVLVKKGTTFVALYGLG
NIRDERLNRMFQTPHAVQWMRPETQDGMSVSDWFNILVLHQNRIKTNPKSAINEHFLPRF
LDFIVWGHEHECLIDPQEVPGMGFHITQPGSSVATSLIDGEAKPKHVLLLEIKGNQYRPT
KIPLRSVRPFHYAEVVLKDEVDVDPNDQASVLEHLDKIVRNLIKKSSQPTASRPETKLPL
IRIKVDYSGFSTINPQRFGQKYVGKVANPQDILIFSKSAKKRQTTGVGNIDDSEKLRPEE
LNQQTIEALVAENNLKMEILPVDDLDIALHDFVSKDDKMAFYACLQRNLEETRTKLNSEA
DKFKIEEEDIIVKVGECMQERVKERSLRSKEDSRFTSSSQNLDTGGRSVTAQSNLNSFSD
DEDTREMLLGARTTNAGRKASGFTRPSKDATDVAKTGTSRRGRGRGTASMKQTTLNFSQS
RSSAAIRSEEVQSSSDEENETNEANEVVESSEPEESPQQTGRKRAAPRGGRGRGRGATAK
RGRKADISSIQSMLMSKDDDDDDEDDRPKKPPPRVTRNYGAVRRR
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgggagacgaaagcaacacactccgtgtacttgtggcaaccgattgccatctcggctac
atggaaaaggacgagattcgtaggtttgattcatttgaggcgtttgaagagatatgctca
ttagcagagcagaataaggttgattttgtgctacttggtggtgaccttttccatgagaac
aaaccttcacgttcaaccttagttaagaccattgagattctacggcgttactgcttgaat
gaccagccagtgaagttccaggttgtcagtgatcagacaatcaactttccaaacagattc
ggccaagtaaattatgaagatccaaacttcaatgttggattgcctgtgttcactatccat
ggaaaccatgatgatccagctggtgtggataatctctctgcaattgatattctctcagcc
tgcaatcttgtaaattattttgggaagatggaccttggtggctctggtgttggtgaaata
gcagtctatcctgtactcgtaaaaaagggtacaacttttgttgcgctctatggccttgga
aacattagagatgaacgattaaacaggatgtttcagacacctcatgctgtacaatggatg
cgacctgaaactcaagatggaatgtcagtatctgactggttcaatattcttgttcttcat
cagaataggataaaaacaaaccctaaaagcgcaatcaatgagcatttcttaccacgtttt
ctggactttatagtatggggccatgagcatgaatgccttattgatccccaggaggtacct
gggatgggttttcacatcactcaaccaggctcatcagttgcaacctccctgattgatggt
gaagcaaaaccaaagcatgttctcttgttagaaatcaagggaaaccagtataggccaacc
aaaatacctttgagatccgttaggccctttcactatgctgaggttgtgttaaaagatgaa
gtggatgttgatcccaatgatcaggcctctgttcttgaacatttggataaaattgtaaga
aatcttattaagaagagtagtcagccaacagccagtagaccagagaccaaacttccacta
attagaatcaaggtagattactctgggttttcaacaattaatccacaacgatttggtcag
aagtatgtcgggaaggttgcaaacccccaggatattcttatcttctcaaaatcagcaaaa
aagcgtcagactactggagtaggcaatattgatgactctgagaaacttcgtcccgaggaa
ctaaaccaacaaactattgaagctttggttgccgaaaataacttgaaaatggagattctt
ccagttgatgacttggacattgcattgcatgattttgtgagcaaggatgacaagatggcg
ttttatgcctgtttgcagcggaatcttgaagaaaccagaactaaattgaattcagaggca
gataaatttaaaatagaggaagaagatataatagtcaaagttggcgagtgcatgcaggaa
cgtgtgaaggaaaggtccctccgctccaaggaagattcacggttcacgtcaagctctcaa
aacttggatactggaggtagatctgttacagctcaaagtaacctgaactctttcagtgat
gatgaagacaccagggagatgcttctcggtgcaagaacaactaatgctggaaggaaagca
tctggatttacaagaccctctaaagatgctaccgatgttgccaaaactggaacttccaga
aggggcaggggaagagggacggcctcaatgaagcagaccactctgaatttcagccaatca
aggtcaagtgctgctatccgcagtgaggaagtgcaatcttcttcagatgaggaaaatgag
actaatgaagcaaacgaagttgttgaatcttcagaaccggaggagagtccccaacaaact
ggacggaaaagggcagctcctagaggtggtagaggtaggggtagaggcgctactgcaaaa
aggggtagaaaagcagatatttcatccatccagagcatgctgatgagcaaagatgatgat
gacgatgatgaagatgacaggccgaagaaacctccacctcgggtcactaggaactacgga
gctgttaggaggagatga

DBGET integrated database retrieval system