KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337150
Entry
4337150           CDS       T01015                                 
Name
(RefSeq) DNA polymerase I A, chloroplastic-like isoform X1
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03410  Base excision repair
osa03420  Nucleotide excision repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4337150
   03410 Base excision repair
    4337150
   03420 Nucleotide excision repair
    4337150
   03440 Homologous recombination
    4337150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4337150
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337150
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4337150
DNA replication proteins [BR:osa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     4337150
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     4337150
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     4337150
SSDB
Motif
Pfam: DNA_pol_A DNA_pol_A_exo1
Other DBs
NCBI-GeneID: 4337150
NCBI-ProteinID: XP_015636766
LinkDB
Position
4:32416780..32423961
AA seq 1032 aa
MAAPAPAPAPAQLRRCPCSAPLWAAPSPFRCCGGRRGRSPFIGGGRQDYSHSSSGLGVTD
NSAFKIGVYTNFNVQSNAQEWLEESKRISSIKTRNNVGNTIYKGSTHLRTGILHHEPLED
HKSSNYSSLYNVRERMTPNSLANRHANMELAKHNTRNQAASAVSALTSVVNDDIKPLNRS
SGSELKTQWQPDSKTDASVLKISKVETSLQFDDKARDGYDGDEHECTAKNTVQDSPAKAP
MSKESKDARKALATVYDKVLVVDNVKSARSVVQLLTSKYKNFIHACDTEVANIDVKQETP
VSHGEVICFSIYSGNSDAEADFGNGKTCIWVDVLDGGRDVLMEFAPFFEDPSIRKVWHNY
SFDSHVIENYGIKVAGFHADTMHLARLWDSSRRIDGGYSLEGLTNDHRVMGVVPKELQKI
GKRSMKTIFGWKKIKKDGSAGKIISMEPVEVLQRDDREMWICYSSLDSMSTLRLYESLKS
KLEKKHWTFDGCPRGSMYDFYEEYWRPFGALLVKMETAGMLVDRGYLSEIEKVAVAQRKL
AADKFRKWASKYCPDAKYMNVNSDTQIRQLFFGGIENRCKPGETLPKSRTIKVPNDGSLI
AEGKKTPKYCTIELFSIVEDLKTDLFTASGWPSVSGDALRSLAGKLPTDLVYTTDDVEDD
DSGDSEISEHDLNDTASYGTAYEAFGGGKKGKEACHAIAALCEICSIDSLISNFILPLQG
NHISCDEGRIHCSLNINTETGRLSARTPNLQNQPALEKDRYKIRQAFVAAPGNSLIVADY
GQLELRILAHLASCKSMLDAFKAGGDFHSRTAMNMYQHIRDAVEEKKVLLEWHPQPGQEK
PPVPLLKDAFGAERRKAKMLNFSIAYGKTPVGLARDWKVSVKEAKDTLKLWYRDRKEVLA
WQMKQKELAQEKCEVYTLLGRSRRFPNMAHATSGQRGHIERAAINAPVQGSAADVAMCAM
LEIDRNARLKELGWRLLLQVHDEVILEGPTESADLAKSIVVECMSKPFYGTNILNVELAV
DAKCAQNWYAAK
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggccgctccggccccggcgccggcgcccgcgcagctgcggcggtgcccgtgctccgcg
cctctctgggccgcgccgtcgcccttccgctgctgcggcggccgccgcggccgctcgccg
ttcatcggaggcggaaggcaggactactcgcatagtagctcgggccttggagttacagac
aacagtgctttcaaaattggagtgtataccaacttcaatgtgcaaagtaatgcacaagaa
tggcttgaggagagcaagaggatatcctcgatcaaaaccaggaataacgtgggaaacact
atttataaaggttctactcatctacgaacaggaattcttcatcacgaacctttggaagat
cacaaaagttccaactattcttcattgtacaatgtaagagaaagaatgactcctaattct
cttgcaaataggcatgctaacatggagttggcaaagcataacacgaggaatcaagctgca
agtgctgtgtcagcactgaccagtgttgttaacgatgacattaaaccactcaacaggtct
agtggctctgaactgaagactcaatggcaaccagattctaagactgatgcttccgttctg
aagatctctaaagtcgagacaagcctgcagtttgatgacaaagctagggatggttatgat
ggagatgaacatgaatgcacagccaagaatacagtacaagattctccagctaaggcaccc
atgtccaaggagtctaaagatgcgaggaaggcacttgctactgtgtacgacaaagttctg
gtggttgacaatgtgaagtcagctaggagtgttgttcaattgcttacttcaaagtacaaa
aactttattcatgcatgtgacacagaggtagctaatattgatgttaaacaagagacacca
gttagccatggagaggtcatttgctttagcatctactctggcaactctgatgcagaagct
gattttggaaatggaaaaacatgcatttgggtggacgtgctggatggtgggcgagatgtc
ctcatggagtttgctccattttttgaggacccctcaatcaggaaggtttggcacaactat
agttttgatagccatgtcatagagaactatggaatcaaagttgctgggtttcatgctgat
acgatgcatcttgcacgactttgggactcttcaagaagaattgatggaggatattcactt
gaaggacttacaaatgatcacagggtcatgggtgttgtaccaaaggaattacaaaagatt
ggaaagagatcaatgaaaaccatctttggttggaaaaagattaaaaaggatggatctgca
gggaaaattatctctatggagcctgtcgaagtattacaaagggatgacagagaaatgtgg
atctgttattcttcattagattcaatgagtaccttacgactttatgaaagtttgaaaagc
aagctggaaaaaaagcactggacttttgatggttgccctagaggttcaatgtatgatttc
tacgaggagtattggcgtccttttggtgcccttcttgtcaagatggaaacagctggaatg
ctagtcgaccgtggttacctttcagaaattgaaaaggttgctgttgcacagcgaaaacta
gctgcggataaatttcggaaatgggcatctaaatattgtcctgatgcaaaatacatgaac
gtgaacagtgatactcagattcgccaactgttctttggtggtatagagaatagatgcaaa
cctggtgaaactttgccaaagagtagaactattaaagtaccaaatgatggaagccttatt
gcagagggcaagaaaactccaaagtattgtactattgaacttttcagcattgtggaagat
ctgaaaactgatctatttactgcaagtggctggccttcagtaagtggagatgcattgaga
agtttggctggtaaactgccaactgatcttgtttacacaacagatgatgtagaggatgat
gacagtggtgattcagaaatttctgagcatgatctaaacgacactgcctcttatggaact
gcatatgaagcatttggaggaggaaagaaaggaaaggaagcatgccatgccattgcggct
ctctgtgagatttgttctattgactcgttgatatccaactttattcttcccttacagggg
aatcatatatcatgtgacgaggggcggatccactgttcattaaatataaatacagaaaca
gggcgtctgtcagcaagaacaccaaatttacagaatcaacctgcactggaaaaggatcgg
tataaaatccgtcaagcctttgttgcagctccagggaactctctcatcgttgctgattat
ggtcagctggagctcaggatcttggcacatcttgctagttgtaaaagcatgttagatgct
ttcaaagctggtggtgacttccattccaggacagctatgaacatgtaccagcatatccgt
gatgctgttgaagaaaagaaagtacttcttgaatggcatcctcaacctggccaagagaaa
cctcctgtgcccttgttgaaggatgcctttggtgctgagaggcggaaagctaaaatgctt
aatttctccattgcatatggaaaaacacctgttgggcttgctcgagattggaaggtctct
gtcaaggaagcaaaggataccctgaaactctggtacagggatagaaaagaggttttagct
tggcaaatgaaacaaaaagaattagcgcaggagaagtgtgaagtttacactttgctcggg
cggtcgcgccgctttcctaacatggctcatgcaacttctggtcaaaggggtcacattgag
cgagctgctatcaatgcaccagtacagggcagcgcagcagatgttgctatgtgtgctatg
ctcgagatagatcggaatgctcgtcttaaggaactcggttggaggcttctcttgcaggtg
cacgatgaagtgatactggaagggcctacggaatctgccgatctggccaagtcgattgtg
gttgaatgcatgtccaagcccttctacggcaccaacatcttgaatgttgaactggctgtt
gatgccaagtgtgcgcagaattggtatgcagccaagtag

DBGET integrated database retrieval system