KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337178
Entry
4337178           CDS       T01015                                 
Name
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00061  Fatty acid biosynthesis
osa01100  Metabolic pathways
osa01212  Fatty acid metabolism
Module
osa_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    4337178
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4337178
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     4337178
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4337178
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_C
Other DBs
NCBI-GeneID: 4337178
NCBI-ProteinID: XP_015637090
UniProt: Q0J9M3 A0A0P0WFH4
LinkDB
Position
4:32741474..32746492
AA seq 408 aa
MVTASGLAPPRLAVSCPRAAGRGCGGHHRVGFLRSAPVALAGPAAAQLRCCASTVDDGVV
SAAAAPKPRLPRVVGMGSKLIGCGSATPSLSVSNDDLSKIVETSDEWIAARTGIRNRRVL
SGNETLRELSVQAAKKALEMAQVNADDVDLVLLCTSTPDDLFGGAAQVLAEVGCANAFGF
DITAACSGFIIGLITATRFIKGGGIRNILVIGADALSQFVDWTDRGTCILFGDAAGAVLV
QACSADEDGLLGFCVQSDGNGQKHLNCVSSHVESILSKTNGVPSFPPKKATFSNIEMNGK
EVFRFAVRCVPQSIEKALEEAGLPASSIDWLLLHQANQRIIDAAASRLDIPSDKVISNLA
NYGNTSAASIPLALDEAVRAGKVKAGDVIAASGFGAGLTWGSAIVKWC
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggtcaccgcctccggcctcgcgccaccgcggctggcggtctcctgcccgcgtgcggcg
gggcgcggctgcggcggacaccaccgggttggcttcctccgatccgctcccgtggcgttg
gcggggcccgcggccgcgcagctccggtgctgcgcctccaccgtcgacgacggcgtcgtc
tccgccgcggcggcccccaagccccgcctccccagggtcgtcggtatgggttcaaaactc
attggatgcggatcggccactccatcgcttagcgtttcaaatgatgacctttctaaaata
gttgaaacatcagatgaatggatcgcagcacggactgggattcggaataggcgagttctt
tcaggaaatgagacactgcgcgagctttcagtacaggcagcaaaaaaagctcttgagatg
gctcaagtaaatgctgatgatgttgaccttgttctcctttgcacgtctaccccagatgat
ctgtttggaggtgctgctcaggtgctggcggaggtgggatgcgcaaatgcatttggcttt
gatatcactgctgcatgtagtgggtttattattggtttaattacggctactcgttttatc
aaaggtggaggcatccggaatattctagtaattggtgccgatgctctttcacaatttgtg
gattggacagacagaggtacatgcatcctctttggtgatgctgctggtgctgttttggtt
caggcatgcagtgctgatgaagatggcttgctaggtttttgcgttcaaagtgatggcaac
ggacaaaagcacttaaattgtgtctcgtcgcatgttgagtctatcctgtcgaagaccaat
ggtgtccctagcttcccacctaaaaaggcaaccttctccaacattgaaatgaatggaaag
gaggtttttcgctttgctgtgcgatgtgtgccacaatctattgagaaggcattggaagag
gctggtttacctgcttccagtattgattggttgttgctgcatcaagctaatcagcggatt
attgatgctgctgccagtaggttggatatcccatctgacaaagttatttcaaatcttgct
aattacggaaacaccagtgcggcctcaattccattagcattagatgaggctgttcgagct
ggcaaggtgaaggcaggcgatgttattgcagcatcaggttttggtgctggacttacatgg
ggttcagctattgtcaaatggtgctaa

DBGET integrated database retrieval system