KEGG   Oryza sativa japonica (Japanese rice): 4337213
Entry
4337213           CDS       T01015                                 
Symbol
EME1, OsEME1, OsJ_16416
Name
(RefSeq) crossover junction endonuclease EME1
  KO
K10882  crossover junction endonuclease EME1 [EC:3.1.22.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4337213 (EME1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337213 (EME1)
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     4337213 (EME1)
SSDB
Motif
Pfam: ERCC4 EME1-MUS81_C
Other DBs
NCBI-GeneID: 4337213
NCBI-ProteinID: NP_001406828
LinkDB
Position
4:join(33521885..33522410,33523167..33523394,33523540..33523637,33523962..33524006,33524090..33524155,33524234..33524387,33524473..33524582,33525539..33525714,33526294..33526360,33526432..33526550,33526704..33526793,33527586..33527700,33527786..33527944)
AA seq 650 aa
MASHAAVVEIIDDDDDDDDDVAAASTPPALHKRSHAVAAAAPDSPDAFSPSPPDPKRRQL
AASTIVLDDTPTPPKRRPPPVAADRSASVVADTPRSFVPCSLRNRAIAGDTPDSVLPSPS
FHLDAPDSATPGSDVPCSVGLDDIVPETPGFNSPRLARPPAVPGLTSPMTARKFSGVSCP
ISLDSDDELDDTVYRESLTRTPSNMAKPEHAIQPCTTSCTDKVENTKSTDKKDYSKSNVG
YQTNNSACKNNGTTSYNQPPRANSPCEDSTLKEADPFINNHCPQEENALPIEERKKKQQE
EKRLKKEKKAREIEEKKQKRLETKKQKEAMKAELAELKKLEKEKKKWESGKLATKCIVAE
IDSSVIESGSVGGHLVQGFHEKGLCFRVTSNSIKGSILWKMQIPNEFTQDQASTSQVPYI
LFVLQAEEFCDLVSGGTLLDHVQKVRRQYPEFTICYVTNKLMSFIKRREQNQYNKTTSNS
NSWKRPPVEEALCKLATHYARVRSRHCTDEAEVTEHIVGLTYSLANCKFRKPLTWLSVHA
NGSNISKGCVDKDRIKKSAWLKSLVAIPGVSPGQAIAIEKKYPSMRSLLNVYMDDSKSVH
EKEHLLEDLRLEGPLGDFKRRLGPACSKKVYTILMAQNGAAEVEVDRRGA
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggcgtcccacgccgccgtcgtcgagatcatcgacgacgacgacgacgacgacgacgac
gtcgccgccgcctccacccctcccgccctccacaagcgctcccatgcggtcgccgccgcc
gcccccgattcccccgacgccttctccccttcccctccagacccgaagcggcggcagctc
gcggcgtcaaccatcgtgctcgacgacacccccacccctccgaagcggcggccgccgccg
gtagctgccgaccggtccgcctccgtggtggcagatacgccccggtcgttcgtgccgtgc
tcgctccgcaaccgcgccattgctggtgatacgcccgattctgttctcccgagcccgtcg
ttccacctcgacgctcccgattccgcgacccctggctcggatgtcccgtgctccgtcggg
cttgacgacattgttcctgagaccccgggcttcaactccccacgcttggctcgtcccccg
gccgtgcctggcttgacgtctcctatgaccgcgaggaaattttctggagtatcttgtcca
atatctctggatagtgatgacgaattggatgacactgtatacagggagtctttaaccagg
acgccaagcaatatggcgaagccagaacacgcaattcagccttgtactacttcctgtact
gataaagttgagaatacaaaaagtacagataagaaggattattcaaaatcaaatgttgga
tatcaaacaaacaattctgcatgcaaaaataatggaacaaccagctacaatcaaccccct
cgtgctaattctccttgtgaagattctaccttgaaggaggctgatccttttatcaataac
cattgtccgcaggaagaaaatgccctaccgattgaagaaaggaagaagaaacaacaggaa
gagaagagactaaagaaggaaaagaaagccagagaaatcgaagaaaaaaaacaaaaacga
ctggaaaccaaaaagcaaaaggaagctatgaaagctgaactagcagaattgaagaagctg
gagaaagaaaaaaagaagtgggaatcagggaagttagctacaaaatgtattgttgctgag
attgactcaagtgttattgaaagtggctcagttggaggtcatcttgtgcaaggatttcat
gagaagggcctttgttttcgagtaacatctaattcaatcaaggggtcaattttatggaag
atgcaaattcctaatgagtttacccaggaccaagcttcaacatcacaagtgccatatatt
ctctttgtgcttcaagctgaggaattctgcgatcttgtaagtggtggtacattactggat
catgttcagaaagttcgaagacagtatccagaattcacaatttgctacgttactaataaa
ctgatgagcttcataaaaagacgtgagcagaatcagtacaacaagaccacatcaaattct
aatagttggaagcgtccaccagtggaagaggccttatgcaaattagcgacacactatgct
agagtgcgctcaaggcactgcacagatgaagctgaagtgacagagcatattgttggcttg
acatatagtcttgcgaattgcaagttcaggaaaccattgacatggttatctgtgcatgct
aatggttcaaatatttctaaaggttgcgttgataaagatcggattaagaaaagtgcctgg
ctgaagtctttagttgctattcccggagtcagtccaggacaagctattgcaattgagaag
aagtacccgtccatgagatcactactgaatgtgtatatggatgacagtaaatctgttcat
gaaaaagaacatttgcttgaagacttgaggttggaaggtcctctgggtgattttaagaga
aggctcggaccagcatgctctaaaaaagtgtacacaattctcatggcacaaaatggagcg
gcagaagtggaagttgataggcgtggagcttag

DBGET integrated database retrieval system