KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337291
Entry
4337291           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: 26S proteasome non-ATPase regulatory subunit 7 homolog A
  KO
K03038  26S proteasome regulatory subunit N8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4337291
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4337291
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4337291
SSDB
Motif
Pfam: MitMem_reg JAB Peptidase_M13_N
Other DBs
NCBI-GeneID: 4337291
NCBI-ProteinID: XP_015637189
LinkDB
Position
4:33777471..33781129
AA seq 310 aa
MDVVKAAQLSGRTLEKVVVHPLVLLSIVDHYNRVARDTRKRVVGVLLGTSSRGSVDVTNS
YAVPFEEDDKDPRIWFLDHNYHESMFSMFKRINAKEHVVGWYSTGPKLRENDLDIHALFN
NYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKSQKVFVHVPSQIAAHEVEEIGV
EHLLRDVKDTTISTLATEVTSKLAALKGLDARLREIRGYLDLVIEGKLPLNHEILYHLQD
VFNLLPNLNVNELIKAFAVKTNDMMLVIYLSSLIRSVIALHNLINNKMLNKEHEKAEDSK
PTAIPSAAGS
NT seq 933 nt   +upstreamnt  +downstreamnt
atggacgtggtgaaggcggcgcagctctcggggcggacgctggagaaggtggtggtgcac
ccgctggtgctgctcagcatcgtcgaccactacaaccgcgtcgcccgcgacacccgcaag
cgcgtcgtcggcgtgctcctcggcacctcctcccgcggttccgtcgatgtcaccaactcc
tacgccgtgccgtttgaagaggatgacaaggatccgaggatctggttcctcgatcataat
taccacgaatcgatgttttccatgttcaagaggatcaacgccaaggagcatgttgttggc
tggtacagcaccggtccaaaactcagggagaacgacttggatatacacgcactattcaat
aactatgttcctaaccctgtcctggtgattattgatgttcaacccaaggagttaggaata
cccaccaaagcatactatgctgtggaggaggttaaagagaatgctactcaaaaaagtcaa
aaggtgtttgttcatgttccttcacaaatagctgcccacgaggttgaggaaatcggagtt
gagcatcttctgagggatgtcaaggacacaacaataagcacgcttgcgacagaggtaacc
agcaagcttgcagccttgaaaggactggacgcaaggctcagggagatccgtgggtactta
gatcttgtaattgaagggaagctcccactgaatcatgagattttgtaccacttgcaggat
gtgtttaatctgctccccaatctcaatgtaaacgagcttattaaagcctttgcagttaaa
acaaacgatatgatgttggtcatatacttgtcttctcttatccggagtgtcatcgcactc
cataacttgatcaataacaagatgctaaacaaggagcatgagaaagccgaggattcgaag
ccaaccgccatacctagtgctgctgggagctga

DBGET integrated database retrieval system