KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337373
Entry
4337373           CDS       T01015                                 
Name
(RefSeq) uracil-DNA glycosylase, mitochondrial
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4337373
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337373
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     4337373
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4337373
 Prokaryotic type
     4337373
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 4337373
NCBI-ProteinID: XP_015634353
UniProt: A0A0P0WGI7
LinkDB
Position
4:complement(34383521..34387905)
AA seq 303 aa
MAPPLPPTAPKTIADYLIRPSKRLRPTSPAPAAAASAPLSSSSLSPEQRRRADTNLALAR
ARRHLRLAESKASGGTAKLEELLVEETWLEALPGELHKPYALELCRFVAHERLHSPVPVY
PPPHLVFHALHATPFDRVKAVIIGQDPYHGPGQAMGLSFSVPEGIKIPSSLANIFKELQK
DLGCTVPSHGNLERWAVQGVLMLNTVLTVREHQANSHAKKGWEQFTDAVIKTISLKKSGI
VFILWGNSAQAKTRLIDETKHHILKSAHPSGLSASRGFFGCRHFSKTNQILERLGLSAID
WQL
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcgccgcctctccctcccaccgcccccaaaaccatcgccgactacctcatccgcccc
tccaagcgcctccgccccacctctcccgctcccgccgccgctgcgtcggcccccctctcc
tcctccagcctctcgccggagcagcgccgccgcgccgacaccaacctcgcgctcgcccgg
gcgcgccgccacctccgcctcgccgagtccaaagcgtcgggcggcaccgcgaagctggag
gagctgctcgtcgaggagacgtggctggaggcgcttcccggggagctgcacaaaccctac
gcgctcgagctctgccgcttcgtcgcccacgagaggttgcatagcccggtgcccgtctac
ccgccgccgcatctagtcttccacgcgcttcacgccaccccgttcgaccgtgttaaggcc
gtcatcatcgggcaggatccataccatggacctggtcaggcgatggggttgtctttctca
gtaccagaggggatcaaaattccttctagcttagcaaacatatttaaagagctgcaaaaa
gatctaggttgcaccgtgccttcacatggaaacttggaaagatgggctgtgcagggtgtt
cttatgctcaacactgtattaactgtgagagaacatcaagccaattcacatgccaagaaa
ggatgggagcaatttactgatgctgtcattaagacaatatcactgaagaaatctggaata
gtctttattctctggggaaactcagctcaagcaaagacaagattgattgatgaaacaaaa
caccacattttgaaatccgctcatccatcagggctgtctgcaagcagaggtttctttgga
tgcaggcacttttctaaaacgaatcagatcttggagaggctgggactatctgccattgat
tggcaactctag

DBGET integrated database retrieval system