KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337426
Entry
4337426           CDS       T01015                                 
Name
(RefSeq) general transcription factor IIH subunit 4
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4337426
  09124 Replication and repair
   03420 Nucleotide excision repair
    4337426
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4337426
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337426
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4337426
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4337426
SSDB
Motif
Pfam: Tfb2 Tfb2_C Helicase_C_3
Other DBs
NCBI-GeneID: 4337426
NCBI-ProteinID: XP_015633748
UniProt: A0A0P0WGE9 Q7XKD9
LinkDB
Position
4:34725056..34730537
AA seq 451 aa
MPQVMVVARNFMDMVAALPAAKLDMLYDSAFICEAVLRSLPPLAKKYALQMLYVSAPVAA
AAMEEWVLDEYAAKHRVAIDRLLQLRVFVEVRDRRKEVSYKMNQKFQGNMQKYLVDGGSL
PREPIPSSVTARLPTLAELESFALEQWECFLLQLINSSQVERGTSFSSSMMRTFQRGLLS
SRDGEAPRLTENGFQFLLMETNAQLWYIMREYISSAEERGVDPTELISFLLELSFHTLGE
AYSLNTLTDVQRNAIRDLAELGLVKLQQGRKDSWFIPTKLATNLSASLSDSSSNKEGFVV
VETNFRMYAYSTSRLHCEILRLFSRVEYQLPNLIVGSITKESLYGAFENGITAEQIISFL
QQNAHPRVADKIPAVPENVTDQIRLWETDRNRVDMTLSHLYEDFPSKDMFDQCCDYARDH
GCLLWEDAKKMRLIVRVEFHSEMREFLRRLR
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgccgcaggtaatggtggtcgcgcggaacttcatggacatggtggccgcgctgccggcc
gccaagctcgacatgctctacgactccgccttcatctgcgaggccgtgctcaggtcgctc
ccgccgctcgcgaagaagtacgcgctgcagatgctgtacgtgtcggcgccggtggccgct
gcggccatggaggagtgggtgctcgacgagtacgccgccaagcacagggtcgccatcgat
aggctgctccaactgagggtatttgtcgaggtgcgcgatcgaagaaaggaggtgagctac
aagatgaaccagaagttccagggcaacatgcaaaagtatttggttgatggtggaagttta
ccaagggaacctataccatcgagtgtcactgcaaggttgcctacattggcagaattagag
tcttttgctcttgagcagtgggagtgcttcttgctgcaattgatcaactcatctcaagtc
gagagagggacaagtttcagctcatccatgatgagaacttttcagcgaggtcttctgagt
tcaagagatggtgaagctccaagattaactgagaacgggttccagtttctgctgatggag
acaaatgctcaactttggtacatcatgagagaatacatctcatcagcagaggaacgtggt
gtggaccccacggagttgatatcatttctattggaacttagttttcatacattaggagag
gcttatagcttgaatactctgaccgatgtccaaagaaatgctattagggatctggcggag
ttgggactggtcaaacttcagcagggtcgaaaggacagctggttcatacctacaaaactg
gctacaaatctctcagcaagcttgtcagattcatcgtctaacaaagagggttttgtagtt
gtggagacaaatttccggatgtatgcgtactcaacttccagattacattgtgaaattctg
cgccttttttcaagagtggagtatcaacttccaaacctaattgtgggatctattacaaaa
gaaagtctttatggtgcttttgagaatgggattaccgctgaacagataatttcattcctt
cagcagaatgctcatcctcgtgttgctgacaagatacctgcagtcccagagaacgttaca
gatcagattaggttgtgggaaacggatcgtaacagggttgatatgaccctatcgcattta
tatgaagattttccaagcaaggatatgtttgatcaatgctgtgattatgcaagagatcat
gggtgcttgctgtgggaggatgcgaagaagatgagattaattgtacgagtggagttccat
tcagaaatgcgtgagttcctccggaggctaagataa

DBGET integrated database retrieval system