KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337428
Entry
4337428           CDS       T01015                                 
Name
(RefSeq) probable allantoinase
  KO
K01466  allantoinase [EC:3.5.2.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4337428
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.5  allantoinase
     4337428
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 4337428
NCBI-ProteinID: XP_015635789
LinkDB
Position
4:34737989..34742719
AA seq 509 aa
MAMAAAKGRVLPLLAVAAALAAALLYRAPFSKSLGGEGCSLLPHDHFWIASERVVTLGRV
GPAAVEVKGGLINAIAVGDYRSFLLRRPVVDYGDAVIMPGLIDVHAHLDEPGRAEWEGFS
TGTRAAAAGGITTLVDMPLNSYPSTVSEETLKLKLDAAKDKLHVDVGFWGGLVPENALNP
SALESLLNAGVLGLKSFMCPSGINDFPMTNSTHIEEGLVTLAKYKRPLLIHAERIPDVQN
EDGIDGELDPKAYTTYLKSRPPAWEEAAIKDLQRAMKDTEIGGRSEGAHIHIVHLSDAKL
LLGFLRYDDAKQNGARVSVETCPHYLAFSAEEVPDGDTRFKCAPPIRDSTNRDNLWEALL
DGHIDMLSSDHSPSAPDLKLMEEGNFLRAWGGISSLQFVLPVTWSHGKKYGISLNQLASW
WSERPAMLAGLKKKGAVLPGYRADIVVWKPEAQFHLDDSHPVYHKHRNISAYLGKQLSGK
ILSTFVGGNLVFAEDKHAKAACGAPILAK
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcgatggcggcggcgaagggcagggtcctgccgctgctggcggtggcggcggcgctc
gcggcggcgctcctctaccgcgcgcccttttccaagagcctgggcggtgaggggtgcagc
cttctcccccacgaccacttctggatcgccagcgagcgcgtcgtcacgctcggacgggtc
ggccccgccgcagtggaggtgaagggagggctgatcaacgcgatcgccgtcggggattac
cggagcttcctgctccggcgaccggtggtggactacggtgacgcggttatcatgcccgga
ctgatcgatgtgcacgcgcatcttgatgagccaggacgtgctgagtgggaggggttctcc
actggtacaagagcagcagctgcaggtggcattacaacattagtggacatgcctcttaat
agctacccgtcaactgtttctgaagaaactctcaagctgaagttggatgcagctaaggat
aaactacatgttgatgtagggttctggggaggcctcgttccagagaatgccctcaatcca
agtgcactagagagcctattaaatgcaggcgtcttagggctcaagtcatttatgtgcccc
tcaggtataaatgacttccccatgacaaattcaactcatattgaggagggcctggttaca
ttggcaaagtacaaaaggccgttacttatccatgcagaacgcatacccgatgttcagaat
gaagatgggatcgatggtgaactagatcctaaagcctatacgacatatcttaaatctaga
ccaccagcatgggaggaagcagcgatcaaagatctgcaacgtgcgatgaaagacacggag
atagggggtcggtcagaaggagctcatattcacatagttcatctctcagatgcaaaactt
ctcttgggcttcttaaggtatgatgatgcaaaacaaaatggtgcaagggttagtgtagaa
acctgtcctcattacctggcgttttcagctgaagaagttcctgatggagatactcgcttt
aaatgtgctcctcctatacgcgattcaaccaacagagataatctctgggaagctctgctt
gatggacacatagacatgttgagctcagaccattcaccatcagctcctgatctcaaactc
atggaggaaggtaacttcttaagggcatggggaggcatatcatctttgcagtttgttctc
cctgtaacatggtcgcatgggaaaaaatacggtatcagtttgaatcaactggcatcatgg
tggagcgaaaggcctgctatgcttgcagggttaaagaaaaagggtgctgttctgccggga
taccgtgctgatattgtggtatggaaacctgaggctcaattccatcttgatgacagccat
cctgtctaccataagcatcggaatatttcggcatatttgggaaagcagctttcagggaag
atactgtccacctttgtgggtgggaatcttgtgttcgctgaagacaaacatgcaaaggct
gcatgtggtgctccaatcctcgccaaataa

DBGET integrated database retrieval system