KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337442
Entry
4337442           CDS       T01015                                 
Name
(RefSeq) DNA mismatch repair protein MSH3 isoform X1
  KO
K08736  DNA mismatch repair protein MSH3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    4337442
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337442
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     4337442
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV MutS_II
Other DBs
NCBI-GeneID: 4337442
NCBI-ProteinID: XP_015633466
LinkDB
Position
4:complement(34869979..34877332)
AA seq 1085 aa
MGKPKQQVLSRFFSPKPRPSAPATADDPPPPPRPPAEPPVAAVVSFSPAKRARALSVSPK
TTAKRAKPSPPPSDYVRRRLLEPPRPPPPAAVNPSGKGYTPLEQQVVDLKARHPDVLLMV
EVGYRFRFFGEDAAVAASVLGIIAHPDHSFLTASIPTFRLGFHVRRLVAAGHKVGVVRQT
ETAAIKAAHGGGAAGTPFARGLSAVYTRATIEAAAGELEGGGAPDEGSRYLVCVVDKEVD
AMGTEGFEVKIGVVAIEVSTGEVVHGEFMDGVSRNGLEAVLLGLAPVEVILGTPISSATE
KLMVAYAGPTSNVRVERTSRLCFSEGGALAELLSLFEKSGVDAPTVENGRHLMEMNEENN
NPRGIEGIMAMPELVIHALALSVRYLKGFGMDRIICFGSSFQPFTANTEMSLSANTLQQL
EVLKNHSDGSLDGSLFQTMNNTCTAFGSRLFRHWLTHPLCDRNQICTRHDAVSEISESIG
SQQYSTNNLQDEVDMSCSSSVRSDLSTILSSVLRMLAGTLDIQRGITRIFHCKATAKEFV
GVVQAILTAGKQLQKLVLEDTDTMSSQHRTVHSPLLRRLINTASSCTVLANAATLVSCLN
KDAADQGDMLNLFIASVDQFPEVAEGHATVEMAKQKLELLITEYRKQLGVRNLEFKTVAG
TTHLIELPVDRKVPSSWMKVNSTKKTIRYHTPEVSKNLENLLLAKEKLAVICRTTWNNFL
MDFGRYYAQFQATVKSLATLDCLYSLATLAKQNKYVRPNFVRENEASQIHIKDGRHPVLE
SLLGVNFVPNDTELHANSEYCQIVTGPNMGGKSCYIRQVALITLMAQVGSFVPASSATLH
AVDGIYTRMGASDSIQHGTSTFYEELSEASNILHNCSSRSLVIIDELGRGTSTHDGVAIA
YATLHYLLKEKKCMVIFVTHYPKILNILREFEGSVGAYHVSYLATRKLLEVADRQMVINN
TETKDLGEITFLYKLVAGASDRSFGLNVALLAQLPSSCIERASVMAAKLQQELSEREKNK
FCRLMDVPRESSPKELCAQPYQGLAEACHRILFNVTSAQSNDELTDTLSSLREAREIALK
AIKGW
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgggcaagccgaagcagcaagtgctctcccgcttcttctcccccaagccgcggccctcc
gcccccgccaccgccgacgatccgccgcctccgcctagacctcccgccgagccgcccgtc
gccgccgtcgtctccttctcgcccgccaagcgcgcgcgcgccctctccgtctcccccaaa
accaccgccaaaagggccaagccctcccctcccccttccgactacgttcgccgcaggctg
ctcgaaccgccccggccgcccccgcccgccgctgtgaaccctagcggcaaaggctacacc
ccgctggagcagcaggtggtcgacctcaaggcgcgccaccccgacgtcctcctcatggtc
gaggtcggttaccgcttccgcttcttcggcgaggacgccgccgtcgccgcctccgtgctc
ggcatcatcgcccaccccgaccacagcttcctcaccgccagcatccctaccttccgcttg
ggcttccacgtccgccgcctcgtcgccgcggggcacaaggttggcgtcgtccgccagacc
gagacggcggcgatcaaggcggcgcacggcgggggcgcggccggcacgcccttcgcgcgc
gggctctcggcggtgtacacgcgcgccactatcgaggccgcggccggggagctggagggc
ggcggcgcgcccgacgaggggagcaggtacctcgtgtgcgtggtggacaaggaggtggac
gccatggggacggaggggttcgaggtgaagatcggggtggtggccatcgaggtttcgacc
ggtgaggttgtgcacggcgagttcatggacggagtctcgaggaatggccttgaggccgtg
ctgcttggcttggcgcccgttgaggtcatcctcgggactccaatatcctctgccacggaa
aagctgatggtggcatatgccgggcctacctctaatgtccgggttgagcgcacctcgcgt
ctttgttttagtgagggtggtgctttagctgaactgctctctttgtttgagaagtctggg
gttgatgctccaactgttgagaatggcagacatttgatggagatgaacgaggagaacaat
aatcctcgtgggattgagggtatcatggctatgccagaactagttatccatgcactggcc
ttgagtgttcgctatctcaagggttttggtatggacaggataatctgctttggttcttca
tttcagccatttacagctaacactgaaatgtctctgtcagcaaatactcttcaacaactt
gaggtattgaagaaccactcagatggttcattggatggatcattgttccaaactatgaac
aacacatgtacagcttttggatccagattgtttagacactggctgactcaccctttatgt
gatagaaatcaaatatgtactcgtcatgacgcggtctctgagatctctgaatcaattgga
tcacaacaatattcaactaacaatctccaggatgaagtggacatgtcttgctcatcttct
gtgagaagtgatctgagcaccattctttcatccgttttgagaatgctggcaggaactctt
gatatacaaagaggaataacaaggattttccactgcaaagccacagcgaaagagtttgtt
ggggtcgtccaagctatcctgacggctggaaagcaactgcagaagcttgttcttgaggat
acagacaccatgtcttctcagcatagaactgtgcactctcctttgttgagaaggctaata
aatacggcttcatcatgtactgtcctggctaatgctgcgacacttgtgtcttgtcttaac
aaagatgctgctgatcaaggagatatgctaaacttattcattgcatctgttgatcagttc
ccagaggttgcagagggtcatgcaactgttgaaatggccaagcagaaattggagctgtta
attactgagtatcgaaagcagcttggtgtgcgcaacttggagtttaaaacagtagctggg
acaactcatttgattgaactaccggtggatagaaaggtaccttcaagttggatgaaagta
aacagcaccaagaaaacaattagataccacactccggaagtctcgaaaaacttggagaat
ttattgctggctaaggaaaagctagcagttatctgcaggacaacatggaataacttcctc
atggatttcggcagatactatgcgcagtttcaagcaactgttaaatctcttgccactctg
gactgcttatactcgcttgccactctcgcaaaacaaaataaatatgtacgaccaaatttt
gttcgtgagaatgaagcaagtcagattcacataaaagatggccgccatccggttctggag
tccctacttggagtcaattttgttccaaatgataccgagcttcatgcaaatagtgagtac
tgccagattgttacaggaccaaacatgggaggaaagagttgctatattcgtcaagttgct
ctaattacattgatggcccaggttggttccttcgtaccagcttcatcagcaacattgcat
gctgttgatggaatttatactcgaatgggcgcgtccgatagtattcagcatggaacaagt
accttttatgaggagttgagtgaagcttccaacatattgcataactgctcatctcggtca
ctagttatcatcgatgagcttggtcgtggtacaagcacacatgatggtgttgctatagct
tatgctacattacactatcttctgaaagagaagaaatgcatggtaatttttgtcactcat
tatccaaagattcttaatattctgagagaatttgaaggttctgtcggtgcataccatgtc
tcatatctagcaacacggaaactgttggaagtagctgatagacagatggtgattaacaac
acagagacaaaggatcttggtgaaatcactttcttatataaacttgttgctggagcttca
gacagaagcttcggtcttaatgttgcgctgcttgcacagcttccatctagctgtattgag
cgcgcttcagtcatggcagccaaacttcaacaggagttaagtgagcgtgagaaaaataag
ttttgtaggctaatggacgttccacgggaaagctctccgaaagagctttgtgcacagcct
tatcaagggctggctgaagcatgccacaggatactatttaacgttacatctgctcaaagt
aatgacgagttaacggatacactatcttctttaagggaagccagggaaattgccttgaag
gcaataaaaggctggtga

DBGET integrated database retrieval system