KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337506
Entry
4337506           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S17, chloroplastic
  KO
K02961  small subunit ribosomal protein S17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4337506
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4337506
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4337506
  Bacteria
    4337506
  Archaea
    4337506
SSDB
Motif
Pfam: Ribosomal_S17
Other DBs
NCBI-GeneID: 4337506
NCBI-ProteinID: XP_015636190
LinkDB
Position
4:35381480..35382265
AA seq 186 aa
MLGCPTGNLIPYPSIRLSFFLSFHGWRGSQGYDSKEERALKMLLTTPFVSSPVRVQGNGG
SGASPWAGAATALRIQAAKQLTGRVVTTKADKTVGVEVVRLAPHPKYKRRERIKKKYQAH
DPDNQFKVGDVVELRRSRPISKTKHFLAVPLPPRDTRRKSQLLPPLQSQSQSQDQDQPPT
PPPSSD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgctgggttgtccgaccggaaaccttatcccctacccgtccatcaggctcagcttcttc
ttgagcttccacgggtggagaggcagccaaggatacgatagcaaggaagagagagcgttg
aagatgctgctgaccaccccgttcgtgtcgtcccctgtgagggtccagggcaatgggggc
agcggcgcctcgccgtgggcgggcgcggcgacggcgctgaggatccaggcggcgaagcag
ctgacggggcgtgtggtgacgacgaaggcggacaagacggtgggggtggaggtggtgcgg
ctggctcctcacccaaagtacaagcggcgggagcgcatcaagaagaagtaccaggcgcac
gacccggacaaccagttcaaggtcggcgacgtcgtcgagctccgccgctcccgccccatc
tccaagaccaagcacttcctcgccgtccccctccccccgcgcgacacccgccgcaagtcc
cagctcctcccgcctctccagtcccagtcccagtcccaagaccaggaccagccacccacg
cctcctccttcctccgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345370
Entry
4345370           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S17
  KO
K02961  small subunit ribosomal protein S17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4345370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4345370
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4345370
  Bacteria
    4345370
  Archaea
    4345370
SSDB
Motif
Pfam: Ribosomal_S17
Other DBs
NCBI-GeneID: 4345370
NCBI-ProteinID: XP_015648498
UniProt: Q6YYA7 Q6YZJ6
LinkDB
Position
8:complement(16546432..16550663)
AA seq 107 aa
MKPVVGIVVSNKMQKSVVVAVDRLFHHKMYNRYVKRTSKFMAHDETEDCNIGDRVKLDPS
RPLSKRKHWVVAEILRRAKVYSPSAAAAAVSAQPGATVQQAEAASKS
NT seq 324 nt   +upstreamnt  +downstreamnt
atgaagccggtggtggggatcgtggtgtcgaacaagatgcagaagtcggtggtggtggcc
gtcgaccgcctcttccaccacaagatgtacaaccgctacgtcaagcgcacctccaagttc
atggcgcacgatgagaccgaggactgtaacatcggcgaccgggttaagcttgatccttct
aggcccttgagcaaaaggaagcactgggttgttgccgagattcttcgtagagctaaggtg
tattctccatcagctgctgcagcagcagtttctgctcaacctggtgccacagttcaacag
gcagaagctgctagcaaatcataa

DBGET integrated database retrieval system