KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337525
Entry
4337525           CDS       T01015                                 
Name
(RefSeq) peroxisomal membrane protein PEX14 isoform X1
  KO
K13343  peroxin-14
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4337525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337525
Membrane trafficking [BR:osa04131]
 Autophagy
  Pexophagy
   Selective cargos
    4337525
SSDB
Motif
Pfam: Pex14_N
Other DBs
NCBI-GeneID: 4337525
NCBI-ProteinID: XP_015639506
UniProt: Q9FW35 Q0DLI1
LinkDB
Position
5:91694..95752
AA seq 501 aa
MATGDPNPTTTPPSQQLQGADPQPQSQQDAAANATPAAVAVREDYVQNAVKFLSHPKVRG
SPVLYRRSFLEKKGLTKDEIDEAFRRVPDPQPSATATAAASPSPSQHPNNQNHSSTVVQP
YAPRQPATPAGSIIVATQPKFSWYRAFVAAGLLLGFGVSAAVFVKKLLLPRLKSWIRKVV
AEGDENEGRQIKSKIDEETAEAVKASASAVSAIAKTNQELLASKDEEKKILVTLTQALDS
QAKELKSLCESLNHSRDSINITREDRFSQYRALEEHAPSAARNGPVNTPWRASQQTNMYG
VPNSDFGSGRPSFASTHNEATPGSFSRSYVETSAAHRGDNRSSGSKPWEMQQYSQQRIGY
GSNSQLSDDGCPETQDNYGGGPSYSYHQNQNQNGKAPAPDIQAEEARPSVYISGAEERSP
PPPPQRRWVPPQPPGVVMPEAVAAIRQPKSLAKQPSSEASQEAAGETHANGASSSSPLPE
EALVNGSDAGRSEIEEQAEAI
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggccactggtgacccaaaccctaccaccactccgccgtcgcagcagctgcaaggagca
gatccccaaccccaatcccagcaggatgccgccgccaacgccactccggcggccgtggcc
gtgagagaggattatgtccagaacgccgtcaagttcctctcccaccccaaggtcaggggc
tcccccgtcctctaccgccgctccttcctagagaagaagggccttaccaaggacgagatc
gacgaggccttccgacgagtccccgatccgcaacccagcgctactgctactgctgctgct
tccccttcgccttcacagcaccccaacaaccagaaccactcttctaccgttgtgcaacct
tatgcaccaaggcaaccagcaacacctgctggctctattattgttgccacacagcccaag
ttcagctggtaccgtgcattcgtcgctgcagggctattgcttggttttggagttagtgct
gctgtgtttgtcaagaaattgctccttcctaggcttaagtcttggatccgcaaggtcgta
gctgaaggtgatgaaaacgagggcaggcaaattaagtccaagatcgatgaggaaactgct
gaagctgtaaaagcttctgcatctgctgtttctgctattgccaaaactaaccaagaattg
cttgcttcaaaggatgaagaaaagaagatacttgtgacattaacacaagcactagattcc
caagcaaaagaattgaaatccttatgtgagtctctgaaccatagcagggattctataaat
attaccagggaagataggttttctcagtaccgggcattggaagagcatgccccttctgct
gcaaggaatgggccagttaacactccatggagagcctctcagcaaactaatatgtatggt
gtgccaaacagtgattttggctcagggaggccttcatttgcgtcaacacataatgaagct
acacctggatcattttcaagatcgtacgttgagacatctgctgcacaccgaggggataat
aggtcttcagggagtaagccatgggagatgcagcaatactcacagcagaggattggctat
ggatccaacagccagttgagtgatgacggatgccctgaaactcaggacaactatggcggg
ggaccttcgtattcgtatcaccagaatcagaatcagaacgggaaggctccggctccggat
attcaagcagaggaggccaggccatcggtatacataagtggggctgaggaaaggtcgcct
ccgcctccgcctcagcgccgctgggttcccccgcagcctccgggcgttgtgatgccggaa
gctgtggctgccatccgtcaaccaaagtccctcgcaaagcaaccgtcgagcgaagcttct
caagaggcagccggcgagacgcatgccaacggtgcttcaagttcgtcgcctcttcctgaa
gaggcgcttgttaatggcagtgacgccggacgtagtgagatcgaagaacaagcagaagcc
atctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268894
Entry
9268894           CDS       T01015                                 
Name
(RefSeq) peroxisomal membrane protein PEX14 isoform X1
  KO
K13343  peroxin-14
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    9268894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9268894
Membrane trafficking [BR:osa04131]
 Autophagy
  Pexophagy
   Selective cargos
    9268894
SSDB
Motif
Pfam: Pex14_N YkyA Synaptobrevin
Other DBs
NCBI-GeneID: 9268894
NCBI-ProteinID: XP_015645700
UniProt: Q657X8 A0A8J8XXN4
LinkDB
Position
1:complement(383227..386737)
AA seq 451 aa
MAAQSSTPSPQDGSGRGEFSDNLVLQTPQPMREDYIQNAVNFLGHPKVKGSPVFYRRSFL
EKKGLTKEEIDEAFRRVPDPQPNSTDVAAVASQQAGIANQSAGVQPYETVQAPQAINTGP
IVPHAQPQLSWSRTLIGVGVFLGVGASAAVILKKLFVPRLKSWIQGAHVEGDEISGNELK
SKFYEEIKAAIQDSASAFSDIAKTNQELLASKDEDKKILTKLAQAFDSQAEAFRSLSDSL
NRMSENRFYQYNLMEDHFQSAPWNGPTTNSWRASQQTNAYNTSPRSDFDSGRHPFMPVPG
EPSPGAFPARSYVEQQRMQRPGYGFQPQMSNDRWNPGSPLTNYHGAPPYQQYHHGSTNAI
DEAPAPAPVPAPAPPAESPFQRRWVPPQPPGVVMPEAVAAIRQPRQQVAAASRPSESAAA
TEQPQSGDVAGGAAMANAGNGEAEQEREAAA
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggccgcccaatcttccactccctcgccgcaagatggttctggtagaggtgaattctca
gacaatttggtacttcaaaccccacagccaatgcgggaggattacatacagaatgctgtt
aactttcttggacatccaaaagtgaagggttctccagtattttacaggcgctcttttctg
gaaaagaaaggccttacaaaggaagaaatcgacgaggccttccgtcgggttcctgatcca
cagccaaacagtacagatgttgcagctgttgcttcacaacaagccggcatcgcaaatcaa
tctgctggagtacaaccttacgagacagttcaagcaccacaagccattaacactggtcct
atcgttccacatgcgcagccgcaacttagctggtcccgtactctcattggtgtaggtgtt
ttcctcggagttggggctagtgctgctgtcatcctcaagaaattgtttgttcctaggcta
aaatcttggatccaaggagcccatgttgaaggggatgaaatttctgggaatgaacttaaa
tccaagttttatgaagaaatcaaagcagccatacaagattctgcatcagcgttttctgat
attgctaaaacaaaccaagagttgcttgcttcaaaggatgaagataagaagatacttaca
aagttggcacaagcatttgattcgcaagcagaggcgtttagatccttgagtgattccttg
aatcgtatgagtgagaataggttttaccagtacaatctaatggaggatcattttcaatct
gccccatggaatgggccaactacaaattcatggagagcttctcagcaaacaaacgcatac
aacacatcaccacgcagtgattttgactccgggaggcatccgttcatgccagtaccggga
gaaccttcacctggagcatttccggcgagatcctatgttgagcagcagcggatgcagagg
cctgggtacggatttcagcctcagatgagcaatgacaggtggaaccctggctcgccattg
acgaactaccacggtgctcctccgtatcagcagtatcaccatggatccaccaacgccatc
gatgaagctccagctccagctccagttccagctccagctccaccagctgaaagcccgttc
cagcgtcgctgggttcccccacagccaccgggcgtcgtcatgccggaggccgtggccgcc
atacggcagccgaggcagcaagttgcagcggcatcgagaccgtcggaatccgccgcggcg
acagagcagccacagtcaggtgacgtcgccggtggcgccgccatggccaatgcgggcaat
ggcgaggccgagcaagagcgggaagctgctgcttaa

DBGET integrated database retrieval system