KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337526
Entry
4337526           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L28, chloroplastic
  KO
K02902  large subunit ribosomal protein L28
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4337526
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4337526
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4337526
  Bacteria
    4337526
SSDB
Motif
Pfam: Ribosomal_L28
Other DBs
NCBI-GeneID: 4337526
NCBI-ProteinID: XP_015639509
UniProt: Q5KQD5 Q9FW34
LinkDB
Position
5:complement(97364..99807)
AA seq 137 aa
MATMLCSFTPATRAPLLRTSSSSSSLGFATSQLAGLSLGLSAAATTAPSAAGPKLHPILA
RRICPFTDKKTNRANKVSFSNHKTKKQQFVNLQYKKLWWEEGKRFVKLRLSTKALKTIEK
HGLDAVAKKAGIDLNKK
NT seq 414 nt   +upstreamnt  +downstreamnt
atggcgaccatgctctgctccttcacgcccgccaccagggctccgctccttcgcacttcc
tcctcctcttcctctctcggcttcgccacctcgcaactcgccggcctcagcctcggcctc
tccgccgcagccaccaccgcgccctccgccgccggtcccaagctccaccccatcctcgcg
cgccggatatgccccttcacggacaagaagaccaacagggcgaacaaggtgtccttctca
aaccacaagacgaagaagcagcagtttgtgaacctgcagtacaagaagctgtggtgggag
gaaggcaagcgcttcgtcaagctgcgtctctccaccaaagccctcaagaccatcgagaag
catggcctcgacgccgtcgccaaaaaggccggcatcgacctcaacaagaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343516
Entry
4343516           CDS       T01015                                 
Name
(RefSeq) 54S ribosomal protein L24, mitochondrial
  KO
K02902  large subunit ribosomal protein L28
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343516
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343516
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4343516
  Bacteria
    4343516
SSDB
Motif
Pfam: Ribosomal_L28
Other DBs
NCBI-GeneID: 4343516
NCBI-ProteinID: XP_015646578
UniProt: A3BKU9 Q6ZL47
LinkDB
Position
7:complement(21576238..21579334)
AA seq 204 aa
MSFRAREMYKKVVRRVGGEGKLPAELMASVKNLLPDSKVVMGRAKRGIYAGRHIQFGNKV
SEDGGNKSRRTWKPNVQEKRLFSYIHDRHIRVKVTTHALRCIDKAGGIDEYLLKTPYNKM
DTEMGVAWKAKIEKMYSQLAQMEVGFFSPEEETKIEQGFEEARAAKREHRREARRALAKQ
TQLEAGNAGGDKTAEAASNVAVKS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtcgttccgtgcgcgggagatgtacaagaaggtggtgcggcgcgtgggcggcgagggg
aagctgccggcggagctgatggcgtcggtgaagaacttgctgcctgacagcaaggtcgtc
atggggagggccaagcgcggcatctacgccggacgccacatccagttcggcaacaaggtc
tccgaggacggtggcaacaagtcaaggcgaacatggaagccaaatgttcaggagaagcgt
ctttttagctatattcacgaccggcacattagggtcaaggtaaccacccatgctcttcgg
tgcattgacaaagctggtgggatagacgaatacctcctgaagacaccttacaacaaaatg
gatactgagatgggggtagcctggaaggcaaagattgagaagatgtattcacagctagct
caaatggaggtaggcttcttctctcctgaggaagagactaagatcgaacagggttttgag
gaggctcgagctgccaagagagagcaccgcagggaagcaagaagagctttggctaagcag
actcagctagaagctggtaacgctggtggtgacaaaacagctgaagctgcttctaatgtt
gcagtgaagtcctag

DBGET integrated database retrieval system