KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337594
Entry
4337594           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit C
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4337594
   03420 Nucleotide excision repair
    4337594
   03430 Mismatch repair
    4337594
   03440 Homologous recombination
    4337594
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4337594
   03032 DNA replication proteins [BR:osa03032]
    4337594
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337594
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4337594
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4337594
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4337594
   MMR (mismatch excision repair)
     4337594
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4337594
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N zf-CCHC tRNA_anti-codon zf-CCHC_2 DUF5521 zf-CCHC_5 UPF0515
Other DBs
NCBI-GeneID: 4337594
NCBI-ProteinID: XP_015638722
UniProt: Q65XV7
LinkDB
Position
5:593325..597985
AA seq 951 aa
MEPQLTPGAVQAIAEHPDGTGTIQPVLQVVDVRPVTTKNAPPTPKPAERFRMMLSDGVNT
QQSMLATALNPLVKDATLRPGTVVQLTDFMCNTIQGKRIIIVVKLDVLQNDCIVIGNPKH
YEPKSLTKEQDPNLQASVAQTNNGTYSGGASMLGPSVAPRAEQAASNSSYGGPYNSAQGM
LGSSIGRTVEPGPANVSAVGSYGAISAQNTTNANMMQPTSQLNIMNANTMQPTSQLNTMN
ANTMQPTSQLSSLNPNQNQRFAAPASGGVFGPPGNAYGQPSRPSYQQPPPVYMNRGPASR
NDSATRIIPITALNPYQPKWTIKARVTAKSDIRHWSNARSSGTVFSFDLLDAQGGEIRAQ
CWKESADKFFGQIEVGRVYLISRGSLKPAQKKYNTLNHDYEITLDIGLSTVEVCSDDDNS
IPRLQYNFRQISELENMANETIVDLLGVVTSVSPSATIMRKIGTETRKRSIQLKDLSGRS
IEVTLWGNFCDAEGQQLQLQCDSGSNPIIAFKGARVGDFNGKSVSTIGSTQLIINPDFPE
VERLRQWYMTEGKTAPCISLSREMLNMGRTDARKTIAQIKDENLGRLEKPDWITVKAAIS
HVTTESFCYPACPKLLPVGRQCNKKAINNGDGMWHCDRCDESFQNPEYRYMLRFQIQDHT
GSTYASAFDEAGEQIFGRKAGELFSIRNVDQDDAQFAEIIEGVRWHLYLFKLKVKEETYN
DEQSLKCTAVKVEKLDPSKESNVLLGAIDNLLLDPKGQSDLAPNAGFTDPVGGHGAPTSS
NAYAMNTGGVNQFGQQASISAGMSTPLAATRNLQTCSICGANGHSAQICHVGADMDMQET
SAGGSSMGNYNSIAGNGSSECYKCKQPGHYARDCPGQSTGGLECFKCKQPGHFSRDCPVQ
STGGSECFKCKQPGHFARDCPGQSTGAQHQTYGNNVAASRGYNRQSFVGGY
NT seq 2856 nt   +upstreamnt  +downstreamnt
atggagccgcagctgacgccgggggcggtgcaggcgatagcggagcacccggacgggacg
gggacgatccagccggtgctgcaggtggtggacgtgcggcccgtcaccaccaagaacgcg
ccgcccacgcccaagcccgccgagcgcttccggatgatgctctccgacggcgtcaacacg
cagcagtccatgctcgccaccgccctcaaccccctcgtcaaggacgccacgctccgcccc
ggcaccgtcgtccagctcaccgacttcatgtgcaacaccatccagggtaaaaggattatt
attgttgtgaaacttgatgttctgcaaaatgactgcattgtaattgggaaccctaaacac
tatgaaccaaagagtctaactaaggagcaagaccctaacttacaggccagtgtggctcaa
accaataatggaacctattctggtggcgcaagcatgctgggcccctccgttgcgccaagg
gcagagcaggctgctagcaacagttcatatggtggaccttataatagtgctcaaggaatg
ttgggttcttctattggcaggacagttgaacctggtcctgcaaatgtttctgctgttggc
tcttacggtgcaatatcagcacagaacacaacgaatgccaacatgatgcagcctacatct
cagctgaacataatgaatgccaacacgatgcagcctacatctcagctgaacacaatgaat
gccaacacgatgcagcctacatctcagctgtcctcgttgaaccctaatcaaaaccaaagg
tttgcagctcctgcttcgggtggagtctttggccctcctggcaatgcttatgggcagcct
tcacgtccttcatatcagcagccacctccagtgtatatgaatagagggcctgcctctagg
aatgactctgcaactcgtatcatcccaattaccgcgttgaatccataccagcctaagtgg
acaatcaaggcaagggtgacagcaaagtctgatatcaggcattggagcaatgccaggagt
tcaggaacagttttctcgtttgatcttcttgatgcacaaggtggagaaattcgtgcacaa
tgctggaaagaatcggctgataagttttttggccaaattgaggttggtagggtgtatttg
atatctagaggatcactgaagcccgcccagaagaagtataacactttgaaccatgattat
gaaataactctggatatcgggttatcaactgtcgaggtttgctctgatgatgataacagc
atccccaggctgcagtacaatttccggcagatcagcgaactagagaatatggctaacgag
accattgttgatttacttggtgttgttacatcagttagcccttctgcaacaataatgagg
aagatcggcactgaaacccggaaaaggtctattcaactgaaggacttgtctggccggagc
attgaagtaacattatggggaaacttctgtgatgctgagggtcagcagttgcagttgcag
tgtgattctggttcgaaccctataattgcttttaaaggtgcccgtgtgggtgattttaat
ggcaaatcagtgagcacaattggttcaacccagttaattataaatccagactttcctgag
gtggaaaggctgaggcagtggtacatgacagaaggaaaaactgctccttgcatttcttta
tctcgagaaatgcttaatatgggccggactgatgcccgcaaaacaattgcacagatcaag
gatgaaaatttgggacgattagagaagccagactggatcactgttaaggctgcaatctcc
catgtgactactgagagtttttgttatccagcttgcccaaagctcttgcccgtcgggagg
cagtgtaataaaaaggcaataaataatggtgatgggatgtggcattgtgaccgatgtgat
gagagttttcaaaatcctgaatataggtacatgcttaggttccagatccaagaccacact
ggtagtacctatgctagtgcgttcgatgaggcaggtgagcagatttttggtcgcaaggca
ggagaacttttctcgataagaaatgtcgaccaagatgatgcacaatttgcagagatcata
gaaggggtccggtggcatctatatctattcaaactgaaggtcaaggaagaaacctacaat
gatgagcaaagcttgaaatgcaccgctgtcaaggttgaaaaactggacccatcaaaagag
agcaacgtcctacttggagcgattgacaaccttttactggacccaaaggggcaaagtgat
cttgcccctaatgctggtttcaccgatccggtaggcggtcacggtgcgcctacatctagc
aatgcctatgccatgaatactggtggcgtgaatcagtttgggcagcaagcgagtataagc
gccgggatgtctactccactagcagcaacacgaaacttgcagacatgcagcatttgtgga
gcaaatgggcacagcgcccagatctgccatgtgggtgcagatatggatatgcaggaaaca
tcagccggtggaagctccatgggtaactacaactccatcgctggcaacggcagctcggag
tgttacaaatgtaaacagcccgggcactatgctagagactgtccagggcagtccactggt
ggcttggagtgtttcaaatgtaaacagcctgggcacttttctagagactgtccagtgcag
tctactggtggctcggagtgtttcaaatgtaaacagcctgggcacttcgctagagattgt
ccagggcagtctactggcgcccagcaccagacatatgggaataatgttgcagcatcaagg
ggttacaataggcaatcctttgttggtggctactga

DBGET integrated database retrieval system