KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337655
Entry
4337655           CDS       T01015                                 
Name
(RefSeq) DNA repair protein RAD51 homolog 2
  KO
K10869  RAD51-like protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4337655
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337655
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     4337655
SSDB
Motif
Pfam: Rad51 AAA_25 ATPase RecA AAA_24 DnaB_C AAA_22 ABC_tran DUF6531
Other DBs
NCBI-GeneID: 4337655
NCBI-ProteinID: XP_015639331
UniProt: Q60F40 B9FM74
LinkDB
Position
5:complement(1172058..1190649)
AA seq 363 aa
MANKLVSEMRLPPHLAHILAARRLTTAKDVLSLPEVELMGVLDAGIHTARAAVAHVSEIA
CPPYQTALALLEAFRARGDGRLATTLRGLDEALHGGIPAGKLTEVVGPSGIGKTQFCLKL
ALLATLPECYGGLNGRVLYIDTESKFSSRRMIEIGEKSFPQIFRQEGLAQKMAGRILVLR
PTSLSEFTKSLEQMKVTLLQHDVKLLVVDSMAALMSSEIEKSATGLRQHPLRWALSFLKS
IAEFSQIPVVVTNQVRSQSNDDGYRYSFEVEKKYDSNNAEGFESHLVAALGIQWAHAVTI
RLVFEAHSGHRYIKVAKSPMTPAVAFPFTVESSGIILLSDEGIDVPSPEITSIRCQGENV
LAQ
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcgaacaagctggtctcggagatgcggctacctccccacctcgcccacatcctcgcc
gcgcgccgcctcaccaccgccaaggacgtgctgtcgctgccggaggtggagctcatgggc
gtcctcgacgccggcatccacaccgcccgcgccgccgtcgcccacgtcagcgagatcgcc
tgccctccgtaccaaacggcgcttgcgctcctcgaggccttcagggcaagaggagatggg
cggctggccaccacgctccgcggattggatgaggcattgcatggaggaatccccgcaggg
aagctcactgaggtcgttgggccctcggggattggcaagacccagttctgtctgaagctt
gctttgctagcaacattaccagaatgctatggaggcttaaatggtcgagttttgtatatt
gatactgaatccaaattctcttcacggaggatgatcgagattggtgagaaaagctttcct
caaatatttcgtcaagaaggcttggcccaaaagatggctgggaggatcctagtcctgcgc
ccaacatcattatctgaatttaccaagagtttggaacagatgaaggtgactcttcttcag
catgatgtgaagctacttgttgttgatagcatggctgctcttatgtcatctgagattgag
aaaagcgcaacaggtctcagacaacaccctctaagatgggccctttcatttcttaaatct
atagcagagttctcacagattcctgttgttgttacaaaccaagtacgcagccaaagtaat
gatgatggctatcgttattcatttgaagttgagaagaaatacgatagtaataatgctgaa
ggctttgaatctcatcttgttgctgctctaggaatccagtgggctcatgctgtaactata
cgtctagtctttgaggctcactcaggtcacaggtacatcaaggtagctaaatcccctatg
actccagcggtagcttttccctttactgtggagtcatcaggaataatattacttagtgat
gagggcattgatgtgccatctcctgaaataacctcaatccgttgtcaaggagaaaatgtc
ctggctcaatga

DBGET integrated database retrieval system