KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337697
Entry
4337697           CDS       T01015                                 
Name
(RefSeq) acetylornithine aminotransferase, mitochondrial
  KO
K00818  acetylornithine aminotransferase [EC:2.6.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4337697
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4337697
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     4337697
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class III
   4337697
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 4337697
NCBI-ProteinID: XP_015639543
UniProt: Q688Q8
LinkDB
Position
5:1704868..1707100
AA seq 465 aa
MNSLQSFLALNPPAAAAALGGARLRPSRVTACLATPTPTPPPPTSAPLAPAAAAARRELS
AASRAVVEDEARYIVGTYNRSRVVLVAGRGCKLYDADGREYLDMAAGIAVNALGHADPDW
VAAVSAQAATLVHASNVQYTVPQVALAKRLVEASFADRVFFANTGTEANEAAIKFARKFQ
RVARPDGDAPTEFMSFTNCFHGRTMGSLALTSKVQYREPFAPVMPGATFAEYGNLEEAKK
VIQSGKIAAVFVEPVQGEGGIHSATKEFLQGLRDACDEAGALLVFDEVQCGLGRTGYLWA
YEAYGVLPDIMTLAKPLAGGLPIGVVLVTEKVASAINFGDHGTTFGGGPLVCQAALTTLD
KIQKPGFLAEVAKKGENFKQLLSTKLSGNAHVKEIRGIGLIVGIELDVPAGPLVDACLDR
GVIVLTAGKGNVVRLVPPLIISEKELEQAAEVIRDCLPALDASTS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaactcgctccaatccttcctcgccctcaacccgcccgccgccgccgccgccctcggc
ggcgcgcgcctccgcccgtcgcgcgtcaccgcgtgcctcgccacgcccacgcccacgccg
ccgcccccgacctccgcgcccctcgcccccgccgccgcggccgcgcgccgcgagctgtcc
gccgcgagccgcgccgtggtggaggacgaggcgaggtacatcgtcgggacgtacaaccgc
tcccgcgtcgtcctcgtcgccggccgcggctgcaagctgtacgacgccgacgggcgcgag
tacctcgacatggccgccggcatcgccgtcaacgcgctcggccacgccgaccccgactgg
gtcgccgccgtctccgcccaggccgccaccctcgtccacgccagcaacgtccagtacacc
gtcccccaggtggcgctcgccaagcgcctcgtggaggcctccttcgcggaccgcgtcttc
ttcgccaacaccggcacggaggccaacgaggcggccatcaagttcgccaggaagttccag
agggtggcgcgccccgacggcgacgcgcccaccgagttcatgtcgttcaccaactgcttc
catggcaggaccatggggtcgctcgcgctcaccagcaaggtccaataccgggagccattc
gcgccggtgatgcccggcgcgacgttcgccgagtacgggaacctagaggaggccaagaag
gtgatacagtctggcaaaattgctgccgtgttcgtcgagcccgtgcagggcgagggtggg
atccatagtgccaccaaggagttcttgcaggggctgcgggatgcctgcgatgaggctgga
gctctcttggtctttgatgaggtgcaatgtggtctgggacgcacaggttacctctgggcg
tatgaagcctatggagtactacctgacattatgaccttggcaaagccattggccggtggt
ctccccattggtgtagtcttggtcaccgagaaggttgcttcagcaataaacttcggcgac
cacggtaccacattcgggggaggccctcttgtttgccaagctgcattgaccacattggat
aagatccagaaacctggcttcctagcagaggtggccaagaaaggagagaacttcaagcag
cttctcagtaccaagctgagcggaaacgcccatgtgaaagagatccgggggatcggtctc
attgtcggcatcgagctcgatgtcccagcgggtcctttggttgatgcgtgcttggatcgc
ggtgtcatagtgctgacagctggtaaaggcaatgttgtgaggctggtgccgccactcatc
atctcggaaaaggagcttgagcaggctgcagaggtgataagggactgtctacctgcactt
gatgcctctacctcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343164
Entry
4343164           CDS       T01015                                 
Name
(RefSeq) acetylornithine aminotransferase, mitochondrial
  KO
K00818  acetylornithine aminotransferase [EC:2.6.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4343164
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4343164
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     4343164
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class III
   4343164
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 4343164
NCBI-ProteinID: XP_015647999
LinkDB
Position
7:complement(16208790..16211219)
AA seq 441 aa
MNSLQSFLALNPPATAAALGGLGLGGARLRPSRVTACLATPTPTPPPPTSAPLAPAAAAR
RELSAASRAVVEDEARYIVGTYNRSRVVLVAGRGCKLYDADGREYLDMAAGIAVNALGHA
DPDWVAAVSAQAATLVHASNVQYTVPQASLERRLVEASFADRVFFANTGTEANEAAIKFA
RKYQRVARPDGDAPTEFMSFTNCFHGRTMGSLALTSKVQYREPFAPVMPGATFAEYGNLE
EAKKVIQSGKIAAVFVEPMQGEGGIHSATKEFLQGLRDACDEAGALLVFDEVQCGLGRTG
YLWAYEAYGVVPDIMTLAKPLAGGLPIGVVLVTEKVASAINYGDHGTTFGGGPLVCQAAL
TTLDKIQKPGFLAEVAKKGENFKQLLSTKLSGNAHVKEIRGIGLIVGIELDVPAGPLVDA
CLDRGVIVLTAGKGNVVRQCC
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaactcgctccaatccttcctcgccctcaacccgcccgccaccgccgccgcccttggc
ggcctcggcctcggcggcgcgcgcctccgtccgtcgcgcgtcaccgcgtgcctcgccacg
cccacgcccacgccgccgcccccgacctccgcgcccctcgcccccgccgcggccgcgcgc
cgcgagctgtccgccgcgagccgcgccgtggtggaggacgaggcgaggtacatcgtcggg
acgtacaaccgctcccgcgtcgtcctcgtcgccggccgcggctgcaagctgtacgacgcc
gacgggcgcgagtacctcgacatggccgccggcatcgccgtcaacgcgctcggccacgcc
gaccccgactgggtcgccgccgtctccgcccaggccgccaccctcgtccacgccagcaac
gtccagtacaccgtcccccaggccagtctcgaacgccgcctcgtggaggcctccttcgcg
gaccgcgtcttcttcgccaacaccggcacggaggccaacgaggccgccatcaagttcgcc
aggaagtaccagagggtggcgcgccccgacggggacgcgcccaccgagttcatgtcgttc
accaactgcttccatggcaggacaatggggtcgctcgcgctcaccagcaaggtgcagtac
cgggagccgttcgcgccggtgatgcccggcgcgacgttcgccgagtacgggaacctagag
gaggccaagaaggtgattcagtccggcaaaattgctgccgtgttcgtcgagcccatgcag
ggcgagggtgggatccatagtgccaccaaggagttcttgcaggggctgcgggatgcttgc
gatgaggctggagctctcttggtttttgatgaggtgcaatgtggtctgggacgcactggt
tacctctgggcgtatgaagcctatggagtagtacctgacattatgaccttggcaaagcca
ttggcgggtggtctccccatcggtgtagtcttggtcaccgagaaggttgcttcagcgata
aactacggcgaccatggtaccacattcgggggaggccctcttgtttgccaggctgcattg
accacattggacaagatccagaaacctggcttcctagcagaggtggccaagaaaggagag
aacttcaagcagcttctcagtaccaagctgagtggaaacgcccatgtgaaagagatccgg
gggatcggtctcatcgtcggcatcgagctcgatgttccagcgggtcctttggtcgatgca
tgcttggaccgcggtgtcatagtgctgacagccgggaaaggcaatgttgtgaggcaatgt
tgctga

DBGET integrated database retrieval system