KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337788
Entry
4337788           CDS       T01015                                 
Name
(RefSeq) DNA repair helicase UVH6
  KO
K10844  DNA excision repair protein ERCC-2 [EC:5.6.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4337788
  09124 Replication and repair
   03420 Nucleotide excision repair
    4337788
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4337788
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337788
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4337788
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4337788
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4337788
SSDB
Motif
Pfam: DEAD_2 Helicase_C_2 HBB ResIII SNF2-rel_dom DEAD
Other DBs
NCBI-GeneID: 4337788
NCBI-ProteinID: XP_015637543
UniProt: B9FME3 Q6AUI3
LinkDB
Position
5:complement(2584801..2590127)
AA seq 758 aa
MKFDLEGLTVHFPYAAIYPEQHAYMGELKRALDARGHALLEMPTGTGKTSALISLITSYS
LASPSRPLRLIYCTRTVHEMEKTLAELRLLFAHLPAAASRSLLALGLSSRKNLCVHPQAS
AAAARDSVDTACRRLTASWVRDRAASDPDSTPLCDFFESFDRAAAAGDLASYMPPGVYTL
ADLRALGRDRGICPYFLARQMVKYANVVVYSYQYLIDPKVASIVSREMQKECVVVFDEAH
NIDNVCIEALSVSIRKQTLEGAERNLRRISQEIDRFKATDANRLRAEYNRLVDGLAQRGN
LPISDAWLANPALPEDILKEAVPGNIRRAEHFLAVLRRLVRFLDGRLETENVENEMPVAF
VASIHSQAGIDQKMLRFCYDRLHSLMLTLEITDTDEFMHIQTICDFATLIGTYTRGFSII
IEPYDERMPDIRDPVIQLSCHDASLAIQPVFERFQTVVITSGTLSPIDLYPRLLNFNPVI
SRSFTMSLTRDCICPMVLTRGSDQLPVSTKFDMRSDPGVVRNYGRLLLEMASAVPDGIVC
FFVSYSYMDGIVNSWNEMGILQDIMQHKLVFIETPDVVETTLALDNYRKACDCGRGAIFF
SVARGKVAEGIDFDRHYGRLVIMFGVPFQYTLSRILLARLEYLRETFQIKEGDFLTFDAL
RQAAQCVGRVIRSKADYGMMIFADKRYSRHDKRSKLPGWILSHLHDAHLNLSTDMALHIA
REFLRRMAQPYDKTGSGGNKTLLTEEDLQNMAQDAMEM
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgaagttcgacctggagggcctgacggtgcacttcccgtacgcggcgatctacccggag
cagcacgcgtacatgggcgagctgaagcgcgccctcgacgcgcgcggccacgcgctgctc
gagatgccgacgggcaccggcaagacgtcggcgctcatctccctcatcacctcctactcc
ctcgccagcccgtcccgcccgctccgcctcatctactgcacccgcaccgtccacgagatg
gagaagaccctcgccgagctccgcctcctcttcgcccacctccccgccgccgcctcccgc
tccctcctcgccctcggcctctcctcccgcaagaacctctgcgtccacccccaggcctcc
gccgccgccgcccgcgactccgtcgacaccgcctgccgccgcctcaccgcgtcctgggtg
cgcgacagggccgcctccgacccggactccaccccgctctgcgacttcttcgagtccttc
gaccgcgccgccgccgccggtgacctcgcctcctacatgccccccggcgtctacaccctc
gccgacctccgcgccctcggccgcgaccgcgggatctgcccctacttcctcgcgaggcag
atggtcaagtacgccaatgtcgtggtctacagctaccagtacctgattgatcccaaggtg
gccagcattgtgtccagggagatgcagaaggagtgcgtcgtcgtcttcgacgaggcgcac
aacatcgataatgtctgcattgaggctctcagtgtcagcatccgcaagcagacgctcgaa
ggtgccgagcgaaacttgcggcgcatctcgcaagagatcgataggttcaaggccactgat
gccaataggcttcgtgctgaatacaacaggctggttgatggattggcacagaggggaaac
ctgccaatatcggatgcttggctcgcgaacccggccttgcctgaggacattctgaaggag
gctgtaccaggaaacatcaggagggctgagcattttcttgctgttttgcggaggcttgtc
aggttcctagatggacgcctggaaacagagaatgttgagaatgaaatgcctgttgccttt
gttgcttcaatccattcccaggctggaattgaccagaaaatgttaaggttttgttatgat
cggctacactctctaatgcttaccttggagataaccgatacagatgagttcatgcacatc
cagacaatttgtgactttgccacattgattggaacttatacacggggcttttctataata
atagaaccctatgatgagagaatgcctgatatccgtgatcctgtgattcagctcagttgc
catgatgcatcgcttgcaatacagcctgtttttgagcgttttcaaacagtagtcataact
tctggtactctcagcccaatagacctctaccctcgccttttgaactttaatcctgttata
agcaggagcttcacaatgtctttaacaagggattgcatatgtcccatggtcttgacaaga
ggaagtgaccagctacctgtcagtacaaagtttgatatgcgtagcgatcctggcgttgta
aggaattatggtcggctcttgctggagatggcttctgctgtgccagatggcatagtttgt
ttttttgtcagttactcttatatggatggcattgtcaacagctggaatgagatgggtatt
ttgcaggacatcatgcagcataagttggtattcattgaaacaccagatgttgttgagaca
acattggctcttgataattacagaaaggcatgtgattgtggaagaggtgctatattcttt
tccgttgccaggggcaaagtagccgaaggtattgattttgatcgacactatggcagactt
gtgatcatgtttggtgttcctttccagtacacactcagcaggatattacttgctaggttg
gagtacctaagagaaacttttcaaataaaggagggtgacttcctgaccttcgatgctttg
aggcaagctgcgcaatgtgttggccgtgtgatccgttctaaagcagattatggaatgatg
atatttgctgacaagagatacagtcgccatgataaacggtctaaactgcctgggtggata
ctgtcacacttacatgatgcgcacctaaatctgagcactgatatggctttgcatatagct
cgtgagttcctacggaggatggcgcagccttacgataagacggggagcggcggcaacaag
actctcttaaccgaagaggatttgcagaatatggcgcaggacgccatggagatgtga

DBGET integrated database retrieval system