KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337822
Entry
4337822           CDS       T01015                                 
Name
(RefSeq) anaphase-promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4337822
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4337822
   03036 Chromosome and associated proteins [BR:osa03036]
    4337822
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     4337822
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    4337822
SSDB
Motif
Pfam: TPR_1 TPR_14 TPR_2 TPR_19 TPR_12 TPR_16 TPR_7 TPR_11 TPR_20 PknG_TPR TOM20_plant
Other DBs
NCBI-GeneID: 4337822
NCBI-ProteinID: XP_015640276
UniProt: A0A8J8YAM9 Q65XE1
LinkDB
Position
5:2852835..2861014
AA seq 561 aa
MEAARESMAALVDAGLYDCAQTLGCFLVSSSPASSEAGMSMKVESLVLHGDALHGEKEFR
RALSAYKQAMQYSKNIPRQATSNTRSSVTATGRSPSPNSSSLAPLNENEVKFKIALCYSA
LREHREALQEMEGIPSKARTLKMNLMLGKLYRISRNNRAAAVCYKECLRQCPYVFEAITA
LAEMGLSSKEFSLIFSQAPNRGGKAPGDSLDAQRWWNRYVEAQCCIASHDYKGGLDIYLD
LMQRFPNNVHILLEIAKVEAIIGRNDEAIMNFEKARLIDPNIMTYMDEYAILLKSKSDYT
KLNKLVHDMLHIDPARPETCLALAALWERKDERKALTYAEKSLRVDDRHITGYIMKGNLH
LLLNRPDLAVTDFRGAQELRADLRSYQGLVRAYLALSKCKDALFTAREAMKVMHQSAKAL
KLVGDVHAISSSGREKARKFYESAIRLEPGFLGAALALADLHVAEGRNKDAVLLLERYLR
QWTDDSLHIKLAQVFAATNMLSDALSHYQSALRINPHNEAAKKGLERLEKQMKGVDPDAP
EEDEENEADDVDGDQDDAELL
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggaggcggcgcgggagtcaatggcggcgctcgtcgacgccggcctctacgactgcgcc
cagacgctcgggtgctttcttgtgtcttcatcacctgcgagcagcgaggctggtatgtcc
atgaaggtggaaagcttggtactgcatggtgatgctttgcatggagagaaagaatttcgc
agggcactgagtgcctacaaacaagctatgcaatacagcaaaaacattcctaggcaagca
acaagtaatactagaagctcagtaactgccactggccggtctccttctccaaattcttca
agtcttgcaccactcaatgaaaatgaggtgaaatttaaaattgcactttgctattctgct
ctacgtgagcatcgtgaagcacttcaagagatggaagggattccttctaaagcgaggact
ctaaaaatgaatctgatgttagggaagctatatcggatatccagaaataatcgtgcagct
gctgtatgttataaagagtgcctgaggcaatgcccttatgtttttgaggctattacagct
ttggctgaaatggggctttcttcaaaggagttctctttgatattctcacaagcaccaaat
cgaggaggcaaggctccaggtgactctttagatgcacagcgttggtggaaccgctatgtt
gaggcccaatgttgcattgcttcacatgattataaaggtggccttgacatatatctagac
ttaatgcagcgattcccgaacaatgtgcacatcttgctggaaattgctaaggttgaagcc
atcataggtaggaatgatgaagctatcatgaactttgaaaaggctcggttaattgatcca
aacatcatgacatatatggatgagtatgcaattctccttaagtcaaaatctgactacaca
aagcttaacaagttggtacatgatatgctgcatattgaccctgcaagaccagaaacatgt
cttgctcttgcagcattgtgggaaagaaaagatgaaagaaaagctttgacatatgctgaa
aagagtctccgagttgatgatagacatataactggatatatcatgaagggaaatcttcat
cttttgttgaatcgacctgatttggcagtcacagacttcaggggagctcaagaacttagg
gccgatcttcgctcttatcaaggattggtacgtgcttatctagcgctctctaaatgcaaa
gatgcattattcactgcacgtgaagcaatgaaggttatgcatcagtctgcaaaagctctc
aaattagttggtgatgtgcatgctatcagttccagtgggagagagaaggctaggaagttc
tatgaatccgccattcgtcttgaacctggatttctgggagctgcattggctttggctgat
ctgcatgtcgctgaaggacgaaataaggatgcagtattgctgcttgaaagatatctaaga
cagtggacagatgattctctacacatcaagttggctcaagtttttgcagcaacgaatatg
ctttctgatgcactttcccactaccaatctgctctaaggataaacccacataatgaggcc
gcaaagaaaggattggaacgcttagagaagcaaatgaagggagtagacccggacgcgcct
gaagaggacgaagagaacgaagctgacgatgtcgacggtgatcaagacgacgctgaacta
ctgtag

DBGET integrated database retrieval system