KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337846
Entry
4337846           CDS       T01015                                 
Name
(RefSeq) U1 small nuclear ribonucleoprotein A
  KO
K11091  U1 small nuclear ribonucleoprotein A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4337846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4337846
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    4337846
 Complex B
    4337846
SSDB
Motif
Pfam: RRM_1 RRM_5 DUF4523 RRM_occluded xRRM Calcipressin CHASE8
Other DBs
NCBI-GeneID: 4337846
NCBI-ProteinID: XP_015640775
UniProt: Q0DKM4
LinkDB
Position
5:3210650..3214117
AA seq 253 aa
MSGEVAAAVGGGAPEENGAPPNVTIYINNLNEKIKLEELKKSLRAVFSQFGKILDVLAFK
TLKHKGQAWVVFEDVASATEALKSMQDFPFHNKPMRIQYAKTKSDIIAKADGTFVPRERR
KRNDEKPEKKQKREQHHDVSQVGLGVNAYPGVYGAPPLSQLPFAGAQKVMMPEIIVPNNI
LFVQNLPHETTPMMLQMLFCQYPGFKEVRMVEAKPGIAFVEYGDEGQATAAMNHLQGFKI
TKDNQMLISYAKK
NT seq 762 nt   +upstreamnt  +downstreamnt
atgagcggcgaggtggcggcggcggtcggcggtggcgccccggaggagaacggcgcccct
ccgaacgtcaccatctacatcaacaacctcaacgagaagatcaagctcgaggaacttaag
aaatcgctccgcgctgttttctcccagtttgggaagattcttgatgttctcgctttcaag
actttgaagcataaaggccaagcctgggttgtgtttgaagatgttgcttcagcaactgag
gctttgaagagcatgcaagacttccccttccataataaacctatgagaatccaatatgcc
aagaccaaatcggatattatagcaaaagctgatggcacctttgtacctcgagaaagaagg
aagaggaacgatgagaaacctgaaaagaagcagaagcgtgagcagcaccatgatgtgagt
caagttggcttaggtgtgaatgcttaccccggtgtttatggagctcctccgctctctcag
ctaccttttgctggcgcacagaaggtcatgatgccggagataattgtaccgaataacatc
ctcttcgtccaaaacctcccacatgagacgacccctatgatgcttcagatgctcttctgt
cagtacccagggttcaaggaagtcagaatggttgaagcaaagcctgggattgctttcgtg
gagtacggcgacgaggggcaggctaccgctgccatgaaccatcttcaggggttcaaaatt
acgaaagataaccagatgcttatctcgtatgcgaagaagtaa

DBGET integrated database retrieval system