KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337876
Entry
4337876           CDS       T01015                                 
Name
(RefSeq) E3 ubiquitin-protein ligase UPL6 isoform X1
  KO
K10589  ubiquitin-protein ligase E3 C [EC:2.3.2.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4337876
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4337876
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     4337876
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   4337876
SSDB
Motif
Pfam: HECT IQ Ribosomal_L10
Other DBs
NCBI-GeneID: 4337876
NCBI-ProteinID: XP_015639480
UniProt: Q0DKJ6 Q5W724
LinkDB
Position
5:3472309..3485107
AA seq 1030 aa
MFFSGDPTARKRVDLGGRSSKERDRQVLLEQTREERRRRLGLRLQNSSATKIQKCFRGKR
DLELARSEVRGNFCSTFGEHCQRVDWSSFGANSDFLRQFLFFFNAKKDSDIAILCQVCNL
LLYYVKHGGDVLRLFGGTNYSSLEPLVIHRVKKLALICVQTVHQKRHDWGSQLLMPPEST
PKPCGSLLETAACLINPKLAWNCKVVGYLQRKKIYCLFRGIIISIPQTARNLEHNNNTSA
LEQVLMLIASHIGDDPCCCPVVDPRWSFSSQLLSIPFLWHRLSHFKKVFSANGLSKYYIH
QIACFLPSCADVLPNDISSNHPGYACVLANVLEAATWILSEPKFASETAADIIAVCTSLL
DALPTITSPTGRADDDDDTPMDDVINGLDADLEKQITAAIDSRLLQHLVNALFRGTISTD
YSYPTGPSDIEVEAVGSICAFLHVTFNTLPAERIMTGLAYRTEIVPALWNFIKRCNENQS
WPQFSKFVSSPPADAVGWLLPVSVFCPIYKHMLKIIDNGEFYEQEKPLSLKDLKSLVLIL
KKALWELLWVIPSHASPAKKVLPNPSGFKKLSIENVKIGARIGLSELLAQLQDWNNRLPF
TSSNDFYSQQATSENFVSQALLGNTRASEIIKLAPFLAPFTSRVKIFTSQLANSRQSTTS
HSALTRHRFKIRRNRLLEDAFDQLSMLSEEDLKGPIRVVFVNEHGVEEAGIDGGGIFKDF
MENITRAAFDVQYGLFKETADHLLYPNPGSGLVHEQHLQYFHFLGSLLGKAIYEGILVDL
PFATFFLSKLKHKYNFLNDLPSLDPELYRHLLSLKHYDGDISQLELYFVIVNNEYGEQSE
EELLPGGRDMRVTSENVITYIHLVANHRLNYQIRAQSTHFLRGFQQLIPNEWINMFNEHE
FQVLISGSLESLDIDDLRSNTNYSGGYHPDHELIDIFWEVLKSFSSHNQKKFLKFVTGCS
RGPLLGFQYLEPKFCIQRAGVPGMEEEDEDRLPTSATCMNLLKLPPYRNKTQLESKLLYA
INAEAGFDLS
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgttcttctccggtgacccgacggcgaggaagcgggtggacctcggcgggcggagcagc
aaggagcgggaccggcaggtgctgctcgagcagacgcgggaggagcggcggcggcggctg
ggcctgcgcctgcagaacagctccgccacgaagatccagaaatgcttcagagggaagaga
gatttggaattggcacgttcggaagttcgagggaacttttgctctacttttggggagcac
tgccagagggttgattggagcagtttcggtgctaattctgatttccttcgtcaattcctg
ttcttcttcaatgcaaagaaagacagtgatattgctatactctgtcaagtctgcaatttg
ctgttatattatgtcaaacatggtggagatgttctaagactctttggtggtacaaattac
tcctcactggaacctcttgtgattcacagggttaaaaaacttgcactcatttgtgtgcaa
actgtacatcagaaaaggcatgattggggcagtcagcttttgatgccgccagaaagcaca
ccaaagccttgtggttcattactcgaaactgccgcttgcttgataaatcctaagcttgca
tggaactgcaaggtagttgggtatcttcagcggaagaagatctattgcttatttaggggg
attattatatccataccgcaaactgcaagaaatttggagcataataacaatacatctgct
ctggagcaagttcttatgcttattgcttcacatattggcgatgatccgtgttgttgtcca
gtagtggatccaagatggagtttctcctctcagcttctatcgattcctttcctctggcat
cgtttatcacacttcaagaaggttttctcagctaatggactcagcaaatattatatccat
cagatagcttgctttttgcctagctgcgctgatgttcttccaaatgatatatcatctaat
catccaggttatgcatgtgttcttgcaaatgttcttgaagctgcaacctggattttgtcc
gagccaaagtttgcttctgaaacagcggctgacatcattgcagtctgtacatcactgctg
gacgcgttgccaaccattacatcacctaccggaagggcagatgacgacgatgacacaccc
atggatgatgtcattaatggtcttgatgctgatttggaaaaacaaattactgcagcaatt
gattcaaggttgcttcaacatttggtgaatgctctgttcagaggcacaattagtacagac
tattcttatccaactggaccgtcagatattgaggtggaagctgtaggatctatatgtgct
tttcttcatgtcacattcaacacattgcctgcagagcggattatgactggcctggcctac
cggactgaaatagttcctgcactatggaacttcataaagcgatgtaatgagaaccaaagc
tggccacaattttccaagtttgtctcttctccgcctgcagatgccgtgggttggctccta
cctgtatctgtattctgtcccatatacaagcacatgttgaagataattgataacggggaa
ttctatgaacaagagaaacctttgtcacttaaagatttgaagtccttggttttaattcta
aagaaggctttatgggaacttctatgggttattccttcacatgcctctcctgctaagaaa
gtgctacccaacccttctggatttaagaagttgtcaattgagaatgtcaagattggggca
aggattgggttatctgaactacttgcacagttgcaagactggaataacaggctcccattt
acttcttccaatgatttctattcacaacaagcaactagtgaaaattttgtctctcaggct
cttcttggcaatactcgagcatctgaaattataaagctggctccctttttagcacctttt
accagcagagttaaaatattcacttcacaattggcaaattctagacaatcgacaacatcc
cattctgctttgacaagacaccggttcaaaataagaagaaatcgacttctggaagacgct
tttgatcagctaagcatgctttctgaagaagaccttaaaggaccaattcgagtggtgttt
gttaatgagcatggtgttgaagaggctgggattgacggaggtggaattttcaaggatttc
atggaaaatatcactcgagccgcttttgatgtgcagtacggtttattcaaggagacagcc
gatcatcttctctacccaaatcctggatctggattggtccatgaacagcatctgcaatac
ttccattttcttggcagtctccttgggaaggcaatctatgagggcatacttgttgatctg
ccatttgcaacattcttcttgagtaaactaaaacacaagtacaacttcttaaatgatctg
ccttcattggatccagaattgtatcgtcatcttctgtctttaaagcattatgatggtgat
atctcgcaattggagttatactttgttattgtgaataacgaatatggtgaacaatctgaa
gaagaactgctcccaggtgggagagatatgcgtgtaactagtgaaaatgttattacttat
atccatcttgtcgccaaccatcggttgaactatcagatccgcgcccaaagcacacatttt
ttgagaggctttcaacaactaataccgaatgaatggattaacatgttcaatgaacatgaa
ttccaggttctcatatctggctctctagaaagcttggacatcgatgacttgcgctcgaac
actaactattctggaggatatcatccggaccatgagcttattgatatattctgggaggtc
ctaaagagcttcagttcgcataatcagaaaaagtttctcaagttcgtgaccggatgttct
cgtggaccactccttggatttcagtacctcgaaccaaaattctgcattcagagggctggt
gttcctggcatggaggaggaggacgaagaccgcttgcctacatcggccacttgcatgaac
ctcctgaagctccctccttatagaaacaagacacaattggaaagcaaattgttgtacgcg
ataaatgcagaagctggttttgatctaagttaa

DBGET integrated database retrieval system