KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337982
Entry
4337982           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 3-kinase, root isoform
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04136  Autophagy - other
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4337982
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4337982
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4337982
   04136 Autophagy - other
    4337982
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337982
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     4337982
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4337982
  Rab GTPases and associated proteins
   Rab associated proteins
    4337982
 Endosome - Lysosome transport
    4337982
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    4337982
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 DUF72 C2
Other DBs
NCBI-GeneID: 4337982
NCBI-ProteinID: XP_015640504
UniProt: B9FMT5 Q5KQK1
LinkDB
Position
5:complement(4854212..4865593)
AA seq 814 aa
MANGGEFRFFLSCDISLPLAFRVDRLLHYPTPTQPSPPQDCTTLATNKKVPELVVECKLY
IDGIQFGLPVSTRLESSGPPYFWNEVMTLTAKYRDLTSLSQLAFTVWDMSSGEDGNIVGG
ATIFLFNNKKQLKTGRQKLRLWPQKEADGRVPTTTPGKVPKNERGEIERLERLVNKHERG
QIQHVEWLDRLFFRAMDKAKEKCERTENLYPSLVVEFCSFEHRVVFQESGANFYAPAPVL
LSNQLVTVWDPELGRTNPSEHKQLKLARSLTRGIIDKDLKPSSNERKCLQRIIKFPPTRS
LQVDEKQLVWKFRFSLMSEKKALTKFVRAVDWSDIQEAKQAVELIRKWETIDVADALELL
SPDFESEEVRAYAVNILERADDEELQCYLLQLVQALRFERSDESCLAHFLVKRAVSNIEI
ASFLRWYVVVELRDTAYARRYYSTYDLLENGMMKFARDDGDEDGFRLWQSLTRQTELMAQ
LGSIMKDVKQVRGSAQKKIDGLRQLLSGVFSELTNFDEPIRSPLAPTVLLTGVIPQESSI
FKSALHPLRLAFKTANGGISKIIYKKGDDLRQDQLVIQMVSLMDRLLKLENMDLHLTPYR
VLATQPDEGMLEFIPSSSLAQILSEHRTITSYLQKFHPDEDGPFGITAQCLETFIKSCAG
YSVITYIMGVGDRHLDNLLLTDDGRLFHVDFAFILGKDPKPFPPPMKLCKEMVEAMGGAE
SQYYTRFKSYCCEAYNILRKSSSLILNLFNLMRRSNIPDITNEENAGLKLQEKFRLDLED
EEAIHFFQDLINESVSALFPQMVETIHRWAQYWR
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggcgaacggcggcgagttccgcttcttcctctcatgcgacatcagcctcccgctcgcc
ttccgcgtcgaccgcctcctccactaccccacgcccacccagccttctcctcctcaagat
tgtacaaccttggcgaccaacaagaaggttccggagcttgttgttgagtgcaaactctac
atcgatgggatacaattcggcttgcccgtgagcacgaggctcgaatcgtcagggccacca
tacttctggaacgaggttatgacgctcaccgcgaaatacagggatctcacctccctttcg
cagcttgcgttcacggtttgggatatgtcatctggtgaggacggaaatattgttggtgga
gccaccatatttcttttcaacaacaaaaagcaacttaaaacaggaaggcagaagctgcga
ctatggccccaaaaggaggcagatggaagagtccccaccacgactcctggcaaggtacct
aagaatgagaggggtgagatagagcgtttggagaggcttgttaataagcatgaaagagga
cagatacaacatgtagaatggttggatcgtcttttcttcagagccatggacaaagctaag
gagaagtgtgaaagaactgaaaatttgtaccctagccttgttgttgaattttgcagtttt
gaacacagagttgtcttccaggaatctggagcaaatttctatgcaccagcccctgtgttg
ttatcaaatcaacttgttactgtatgggaccctgaactaggaagaaccaatccatctgag
cacaaacagttaaagcttgcaaggagcctaactcgtggaataattgataaagatctgaaa
ccaagctcaaatgagcgaaagtgtctgcaaagaattatcaagtttcctcctacacgctct
ttacaagtggatgagaagcagctggtctggaaatttcggttctctttgatgtctgagaag
aaagctcttacaaagtttgttcgtgcagtggactggagcgatatccaagaagctaaacaa
gctgttgaattgattagaaagtgggaaacaattgatgtggctgatgcattagagcttctc
tcaccagactttgaaagtgaggaggttcgagcttatgccgtcaacatacttgaaagggca
gatgatgaagaattacaatgctatttactccagctagtgcaagctcttcggtttgaaaga
tcggatgagtcttgtctggcacactttcttgtaaaacgtgctgtatcaaacattgaaatt
gctagcttccttcgctggtatgtggtcgttgagctgcgtgacactgcatatgcaagacgg
tattacagtacatatgacttgcttgaaaatggcatgatgaaatttgctagggatgatggt
gatgaagacggatttcgactttggcagagtttaacacggcagactgaacttatggctcag
ttaggttctattatgaaggatgtaaaacaagttcgtggtagtgcacaaaagaaaatcgat
ggattaagacaattattatcaggagttttcagtgagcttaccaactttgatgagccaatt
cgttcaccattagcaccaactgttctccttactggggttatacctcaagaatcatctata
tttaaaagtgccttgcatcctttgcgccttgcctttaagaccgcaaatgggggaatatcg
aagataatttataaaaagggagatgatctccgccaagatcagctggttattcaaatggtc
tccttgatggaccggctgctcaaattagaaaatatggatttacaccttactccatatcga
gttcttgcaactcaaccagatgaaggaatgcttgaatttattccttccagttcacttgca
cagattctatcagaacatcgcactattacaagttacctacaaaaatttcatcctgatgaa
gatggtccttttggtataactgctcagtgcttggaaactttcataaaaagctgtgctggt
tactctgtcattacatatataatgggggttggagacaggcatctggataatcttcttcta
acagatgatggacgcctcttccacgttgatttcgctttcattctgggtaaagatccaaag
ccatttccaccaccaatgaaactatgcaaagaaatggttgaggccatgggtggtgcagaa
agccaatactacacgagattcaagtcatactgttgcgaagcatacaacattttaaggaag
tccagtagcctcatattgaatctgttcaacttgatgagaagatcaaatattccagacatc
actaacgaggaaaatgcaggccttaagcttcaagagaaatttcggcttgatctggaagat
gaggaagccatacatttcttccaagatcttatcaacgaaagcgtcagcgctttgttccct
cagatggttgagacaatccatagatgggctcaatactggcgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345232
Entry
4345232           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 3-kinase, root isoform isoform X1
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04136  Autophagy - other
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4345232
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4345232
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4345232
   04136 Autophagy - other
    4345232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4345232
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     4345232
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    4345232
  Rab GTPases and associated proteins
   Rab associated proteins
    4345232
 Endosome - Lysosome transport
    4345232
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    4345232
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2
Other DBs
NCBI-GeneID: 4345232
NCBI-ProteinID: XP_015650281
UniProt: Q6UUD9 Q0J6J5
LinkDB
Position
8:complement(12854430..12874496)
AA seq 827 aa
MPSAPDEAQAGVTTGTADHSSCSGGKEFRFILSQDISLPLSFRVNRFVPDRTLLIERSAP
VLFVECTLYIDGVQFGLSTNTRLKSLGSPYCWNELVTLSAKYRDLTPFSHLAFTVWDMSS
GEDNIYIVGGTTISLFNSKNQLKTGRLRLRVWPNKMADGSLSTSTPGKVPKTKREEIERL
ERVANKYIRGQIPHIGWLDNLIANAADKLEKESERTENLHSSLIVELCSFEHRVVFQEYG
AKLHTSVPSSLVDISKNKLVIACDPEIGRINPSEHKHSVLAWSLARGVNDREMKPSSVDQ
KLIQNILKYPPTRTLNVDEKQLLWKFRFYLTSEKKALVKFLLSVEWSDIQEAKQAVALIP
RWESIDVADALGLLSPVFQNEEVRAYAVGVFERASDEELQCYLLQLVQGLRFERSDRSRL
AHFLVNRALSNYELASFLRWYLVVELHDPSHARRYLCTYEMLEDAIMRSVHKEENGFQVW
QSLIEQAELTAQLRSIMKELSNVKHDAQTKGRILEQLFSGIFSELKNFSEPIPSPLTPTV
LLDGIVPEESLVFKSANYPLCIAFSTVNGGTSKMIFKKGDNLRKDQLVIQIISLMDRLLK
SDNLDLHLTPYQVLATGLEEGLVEFIPSISVAKIIQKTGSIESYLQKCNPDEDGPFGITA
QCLETFIKSCAGYSVITYILGIGDRHLDNLLLQDDGRLFHVDFSYMLGEQPHRFAPPSPP
MKLCKEMVEAMGGTESEYYARFKSYCCEAYNILRKSSNLILNLFYLMTGSNIESITDKGT
SKLQQNFRLDLDDEDAIHFLQGLINESISAFFPQVVETIHQWAQSRR
NT seq 2484 nt   +upstreamnt  +downstreamnt
atgccgtcggcgcccgacgaagcccaagcgggtgtcaccaccggaaccgccgatcattcc
tcctgcagcggcggcaaagagtttcggttcatcctgtcacaggacatcagcctgccgctg
tcgttccgcgtcaaccgcttcgtgccagatcgcaccctgttgattgaaagaagtgctcca
gtgctctttgttgagtgtacactatacattgatggagtacagtttggattgtccacaaat
acaaggttgaaatctttgggatcaccatactgctggaatgagcttgtaacattaagtgcc
aaatacagagacctaacgcccttctcacatcttgcattcacggtgtgggatatgtcatct
ggtgaagacaacatctatattgttggtggaaccactatatctcttttcaatagcaaaaac
caacttaaaactgggaggctgaggctgagagtatggcccaataaaatggcagatggaagt
ctctccacctctacccctggcaaggttcccaagaccaagagggaagaaatagagaggttg
gaaagggttgctaacaagtacatcagagggcagataccacatataggttggctagacaat
ctcattgcaaatgctgctgataaacttgagaaagagagtgagagaactgaaaatttgcat
tctagccttattgttgaactatgcagctttgaacacagagttgtctttcaggaatatgga
gcaaagttgcatacatcagtcccttcatccttagtggatatatctaagaataaacttgtt
attgcatgtgatcctgagattgggcgaatcaatccatctgagcataaacactctgtgctt
gcttggagcttggctcgtggagtaaatgatagagagatgaagccaagctcagttgaccaa
aagttaatacaaaacatcctcaagtatccacccacacgcactttaaatgtggatgaaaag
caattgttgtggaaatttcgtttctatttgacatctgagaagaaagctcttgtaaagttc
ctcctctctgtggaatggagtgacatccaggaagccaaacaagctgttgcgttgattcca
aggtgggaatctattgatgtggctgatgcattggggcttctttcaccagtttttcaaaat
gaggaagttcgtgcttatgctgtcggcgtgtttgaaagggccagcgacgaagaactgcaa
tgctatttgctgcaacttgtacaaggcctgcggtttgaaagatctgacagatctcgtcta
gcacacttccttgtgaatcgggctttgtcaaattacgaacttgctagctttcttcgctgg
tatttagttgttgagcttcatgatccttctcatgcaagaaggtatctatgtacatatgag
atgcttgaagatgctataatgagatcagtacataaggaggaaaatggatttcaagtgtgg
cagagtttgatagagcaggcagaactcactgctcagttacgttctataatgaaggaacta
tcaaatgtcaaacatgacgcacaaactaaaggcaggatattagaacagttattctccgga
attttcagtgagcttaaaaacttcagtgagccaattccatctccattaacaccgactgtc
ctccttgacggaattgtgcctgaagagtcattggtattcaaaagtgctaattatccattg
tgtatagcatttagtactgtgaatgggggtacatcgaaaatgattttcaagaagggagat
aatctccgcaaggatcagttggttattcaaataatctctttgatggatcggttgctcaag
tcagataatctagacttacaccttactccttatcaagttcttgcgactggtctagaagaa
gggttggttgagtttattccttcaatttctgttgcaaagattatacaaaaaacgggcagt
atagaaagttacctacaaaagtgtaatccggatgaagatggcccttttggtataactgcc
caatgtttggaaacttttataaaaagttgtgctggctacagtgtcattacatacatactg
gggattggagacaggcatcttgacaaccttctcctacaagacgatggaagacttttccat
gttgacttctcgtatatgcttggggaacaaccacatcgatttgcaccaccatcaccaccg
atgaaattatgcaaagaaatggttgaggccatgggtggtactgaaagtgaatactatgca
agattcaagtcctactgttgcgaggcatacaacatattacgaaagtccagcaacctcata
ctgaatcttttttatctgatgactggatcaaatattgagagtatcacagacaaagggact
tctaagctacagcaaaatttccggttggatctagacgacgaggatgctatacattttctc
cagggtcttatcaacgaaagtatcagtgctttcttccctcaagtggttgagaccatccat
caatgggcacagtctaggcgttaa

DBGET integrated database retrieval system