KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338009
Entry
4338009           CDS       T01015                                 
Name
(RefSeq) proteasome subunit beta type-7-A
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4338009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4338009
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4338009
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4338009
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4338009
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    4338009
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 4338009
NCBI-ProteinID: XP_015637452
UniProt: Q9LST8 Q0DK75
LinkDB
Position
5:5333727..5336892
AA seq 272 aa
MAGATDLPPKGGFSYDNCARNAMLVEKGLKMPGFLKTGTTIVGLVFQDGVVLGADTRATE
GPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYATGRESRVVTSLTL
LKSHLFSYQGHVSAALVLGGVDVTGPHLHTVYPHGSTDTLPFATMGSGSLAAMSVFESKY
KEGLTREEGIQLVAEAIRGGIFNDLGSGSNVDVCVITKGKTEYLRNHQLPNPRTYVSSKG
YNFTKGQTVVLSTKITQLKPKVEVTEGDAMEE
NT seq 819 nt   +upstreamnt  +downstreamnt
atggccggagcgacggatctccccccgaagggcgggttcagctacgacaattgcgcgagg
aacgccatgcttgtggagaagggcttgaagatgcctgggttcctcaagaccgggactacc
atcgtcggtttggtctttcaggatggtgttgttcttggggcagacacgagggccaccgag
ggtcctatagttgctgataagaactgcgagaaaattcattatatggcgccaaacatatat
tgctgtggagcaggaactgccgctgacactgaggctgtaacagatatggtcagttcccag
cttcaacttcaccgttatgcaactggtcgtgagtccagagttgtaacctctcttacatta
ctgaagtcgcacctttttagctaccaaggtcatgtcagtgctgcccttgttcttggtgga
gtagatgttactgggccacacctgcacactgtttatccacatggctccacggacactctt
ccttttgccacaatgggttctggatcccttgcggcaatgtcagtgtttgaatcgaagtac
aaagaaggcctcacaagggaggagggaatacaacttgttgctgaggcaattcgtggtggt
atcttcaatgacttgggcagtggcagcaatgtggatgtttgcgtaatcaccaaggggaag
acagagtacttgagaaaccaccagttaccaaatccaaggacttacgttagttcgaagggg
tacaacttcaccaaggggcagactgtggtgttgtccacaaagataacacaactgaagccg
aaggtagaggtgacagagggtgatgcaatggaggagtga

DBGET integrated database retrieval system