KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338176
Entry
4338176           CDS       T01015                                 
Name
(RefSeq) DNA replication licensing factor MCM6
  KO
K02542  DNA replication licensing factor MCM6 [EC:5.6.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4338176
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4338176
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     4338176
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4338176
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM6_C MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat Lipoprotein_2
Other DBs
NCBI-GeneID: 4338176
NCBI-ProteinID: XP_015638050
UniProt: Q6F353
LinkDB
Position
5:8312893..8319402
AA seq 830 aa
MEAFGGFFVDEKAARVENIFLEFLRRFKEADAAEAFYETELEAMRSRESTTMYVDFAHVM
RFNDVLQKAISEEYLRFEPYLRNACKRFVMEQRTGENRAPIISDDSPNKDINIAFYNIPM
LKRLRELGTAEIGKLTAVMGVVTRTSEVRPELLQGTFKCLDCGNVVKNVEQQFKYTEPII
CVNATCQNRSKWALLRQESKFTDWQRVRMQETSKEIPAGSLPRSLDVILRHEIVEKARAG
DTVIFTGTVVAVPDVMALTSPGERAECRREAPQRKNGSGVQEGVKGLKSLGVRDLSYRLA
FVANSVQVADGRREVDIRDRDIDGDDSERQKFTEEEEDEVVRMRNVPDFFNKIVDSICPT
VFGHQEIKRAILLMLLGGVHKITHEGINLRGDINVCIVGDPSCAKSQFLKYTAGIVPRSV
YTSGKSSSAAGLTATVAKEPETGEFCIEAGALMLADNGICCIDEFDKMDIKDQVAIHEAM
EQQTISITKAGIQATLNARTSILAAANPTGGRYDKSKPLKYNVALPPAILSRFDLVYIMI
DEPDENTDYHIAHHIVRVHQKREEALAPAFSTAELKRYIAFAKSLKPQLSSEAKKVLVES
YVTLRRGDSTPGTRVAYRMTVRQLEALIRLSEAIARSHLERVVLPAHVRMAVKLLKTSII
SVESSEVDLSDFQDADDGTNVPADNDAGQPTEMDAAPQQDGPENEQAADTGKKKLVITEE
HFQRVTQALVMRLRQHEESVTKDGDGLAGMKQGDLIIWYVEQQNAQGAYSSTAEVKEEVK
CIKAIIERLIQRDGHLIVIDEGAAPAADDGAARRTSESRILAVNPNYVID
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggaggcgttcggcgggttcttcgtggacgagaaggcggcgcgggtggagaacatcttc
ctcgagttcctcaggcggttcaaggaggcggatgcggcggaggcgttctacgagacggag
ctggaggcgatgcggtcgcgggagtccaccaccatgtacgtcgacttcgcccacgtcatg
cgattcaacgacgtcctccagaaggccatctccgaggagtatctcaggttcgagccgtac
ctccggaatgcgtgcaagaggtttgtgatggagcagaggactggcgagaaccgtgcacca
atcatctctgatgatagccctaacaaggacattaacattgccttctacaacataccaatg
ctgaagaggttgagggagcttggaacagcagagattggtaagctcacggctgtaatgggg
gtggttacacggacaagtgaggtccggcctgagttactgcaaggcaccttcaagtgcctt
gactgtggaaatgttgtaaagaatgttgagcagcagttcaagtatactgagccaataata
tgtgtcaatgcaacatgccaaaatcgatcaaaatgggcccttctccgacaagagagcaag
ttcacagattggcagcgggtcaggatgcaggagacatcaaaagaaatacctgctggttca
ctaccacgctccctggatgtcattctgaggcatgagattgttgagaaggctagagctgga
gacacggtcatatttactggaactgttgttgctgttcctgatgttatggctctaacttca
cctggtgagagagcagagtgtcgccgggaggctcctcagcgaaagaatgggtctggtgtc
caagaaggtgtcaagggcttgaaatcactaggagtacgagatctgtcatatcgccttgct
tttgtagcaaactcagtgcaggtggcggatggaaggagagaagtcgacatccgggacagg
gacatagatggagatgacagcgaaagacagaagttcactgaagaagaggaagatgaagtt
gttaggatgaggaacgttcctgattttttcaataagatagttgatagcatatgtcccact
gtctttgggcatcaagaaattaagagagcaatccttctcatgcttttgggtggtgttcac
aagataacacatgaagggataaaccttagaggtgacatcaatgtctgtattgttggtgat
ccaagttgtgcgaagtctcagttcttaaaatataccgctggtattgttccacgatctgtt
tacacatcagggaagtcctcatctgctgctggtttgacagcaactgttgctaaagaacca
gagactggcgaattttgcattgaggcaggagcactcatgttagctgataatggcatctgc
tgcattgatgaatttgataaaatggacatcaaagatcaggttgctatacatgaagcaatg
gaacagcaaaccattagcataacaaaagcaggaatacaagcaactttgaatgcaaggact
tcaattttggcagcagcaaatcccacaggagggcgttatgacaagtcaaaaccactcaag
tataacgtggcattgcctccagctattctttcaagatttgatctggtatacataatgatc
gatgagcctgatgaaaacactgactaccacattgctcatcacattgtgagggtccatcag
aaacgtgaagaagcacttgcccctgcatttagcacggcagaattgaaacgttacattgct
tttgcgaagtccttgaaacctcagctgagttctgaagcaaagaaagttctggttgaatca
tatgttacccttcgtagaggagatagtacccctggtactagggttgcttataggatgaca
gttaggcaactagaggcattaatcaggctttcagaagctattgcccgaagtcatttggaa
agagttgttctcccagcccatgttcgcatggcagttaaattgctcaagacatccatcatc
agcgtggaatcaagtgaagttgatctctctgatttccaagatgctgatgatggcacaaat
gtaccagccgataatgatgctggtcagccaacagaaatggatgctgctcctcaacaagac
ggtccagaaaatgagcaagcggcagatactggtaagaagaagttggttataaccgaagaa
catttccagagagtcacgcaagctttagttatgagactacggcagcatgaagagtctgtc
acgaaagatggagatggtctggctggcatgaagcaaggggatctgataatttggtatgtt
gagcagcagaatgcccaaggagcctatagttctacagcagaggtgaaggaagaagtgaag
tgcatcaaggccatcatagagaggttaatacagagggatggccatctcatagtgatagac
gaaggagcagccccagcggctgacgacggtgctgcacgaagaacatcagagagcagaatc
ctggcagttaatccgaactatgtcatcgattaa

DBGET integrated database retrieval system