KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338271
Entry
4338271           CDS       T01015                                 
Name
(RefSeq) DNA mismatch repair protein MSH2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    4338271
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4338271
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     4338271
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_IV MutS_I ATG17_like
Other DBs
NCBI-GeneID: 4338271
NCBI-ProteinID: XP_015637550
UniProt: B9FNL5 A0A8J8YH18
LinkDB
Position
5:11189351..11198041
AA seq 942 aa
MEGDDFLPEGGKLPELKLDARQAQGFISFFKKLPQDSRAIRLFDRRDYYTAHGENATFIA
KIYYHTMSALRQLGSNSDGLSSVSVSKTMFETIARNLLLERTDRTLELYEGSGSSWRLTK
SGTPGNIGSFEDILFANNDMQDSPVTVALFPVFQEGQLYVGLSFVDLTNRKLGLSEFPED
SRFTNVESALVALGCKECLLPADCEKSIDLKPLQDAITNCNVLLTERKKVEFKSRDLVQD
LGRIIRGPVEPVRDLVSQFDYALGALGALVSYAELLADDTNYGNYTIEKYSLDRYMRLDS
AAVRALNIAEAKTDVNKNFSLFGLMNRTCTVGMGKRLLNRWLKQPLLDVNEINNRLDMVQ
AFVEDPELRQGLRYQLKRMSDIDRLTHALRKRTANLQPVVKLYQSCIRVSYIKNVLQQYD
GSFSALIRTKFLNSLDEWLTEDRFGRFASLVETAIDLDQLENGEYRISPRYSSDLAVLKD
ELSEVENHINNLHKHTAADLDLTIDKQLKLEKGQLGHVFRISKKDEQKVRKKLTSNYIII
ETRKDGVKFTSSKLKKLGDQYQALLGEYTSCQKKVVDDVVRVSASFSEVFENFAAILSEL
DVLQSFADLATSSPIPYVRPEITASEEGDIILEGSRHPCLEAQDGVNFIPNDCTLVREKS
WFQIITGPNMGGKSTFIRQVGVNVLMAQVGSFVPCDRASISVRDCIFARVGAGDCQLRGV
STFMQEMLETASILKGASDKSLIIIDELGRGTSTYDGFGLAWAICEHLVEVTRAPTLFAT
HFHELTALGHKSGDEHQHVPNLGIANYHVGAHIDPSSRKLTMLYKVEPGACDQSFGIHVA
EFANFPEAVVALAKSKAEELEDFSTAPNFSDDSKDEVGSKRKRVFSPDDVTRGAARARLL
LEELASLPLDEMDGTKAAETVTKLKSDFEKDAADNPWLQQFL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggagggcgacgacttcttgccggagggcggcaagctccccgagctcaagctagatgcg
aggcaagcgcagggcttcatctctttcttcaagaaactgccgcaggattcgagggctatt
cgtctcttcgatcggcgggattattacactgctcatggagagaatgccacattcattgca
aaaatatactatcacacaatgtctgccttacgccaattaggtagcaactctgatggactc
tcaagtgtcagtgtgagcaagactatgtttgagaccatcgcccgcaaccttttgttagag
aggacagaccgtacattggaactctatgagggaagtgggtctagttggaggttaacaaaa
tctggaacacctggaaatattggcagttttgaagatattctgtttgcaaacaatgacatg
caagattctccggtaactgttgcattgtttcctgtgttccaggaaggacaactatatgta
ggtcttagttttgttgatttgacaaacaggaagcttgggttgtctgagtttcccgaagat
agtcgattcacaaatgtagagtcagcccttgttgcattaggttgcaaggagtgtcttctc
ccagcagattgtgagaaatctatagatttgaagcctcttcaggatgctatcactaactgc
aatgttctattaactgaaagaaagaaggttgaatttaaatccagagatcttgtgcaggat
cttggtagaataatcagaggtcctgttgagccagttcgtgatcttgtatctcagtttgac
tatgcattgggtgcccttggagctctagtttcatatgctgagttgctagcagatgataca
aactacggaaattacacaattgagaaatacagtttggaccgctacatgcgtcttgattct
gctgctgtgcgagcattgaatattgccgaagctaaaactgatgtaaacaagaacttcagt
ttgtttggtttgatgaacagaacctgtacagtaggtatgggaaagagactgcttaacaga
tggctgaaacaacctctgctagatgtaaatgaaatcaataacagattagatatggttcag
gctttcgtagaagatccagagcttcgtcagggacttaggtaccaactcaaaagaatgtcg
gacattgaccgtctgacacatgctctgcggaagagaacagccaatctgcagcctgttgtc
aagctctaccagtcctgcattagagtctcatacatcaagaatgttcttcaacaatatgat
ggcagtttttctgcgctgataaggacaaagtttcttaattctttagatgagtggctgaca
gaggataggtttggtaggtttgcttctcttgttgagacagctattgaccttgatcaactt
gagaatggtgagtataggatatctccccgatattcttctgatttggctgtgctgaaggat
gagctttctgaagttgaaaatcacatcaacaatttgcacaagcatacagctgctgatctg
gatcttactattgataagcaattgaagctagaaaaagggcagcttggccatgtgttcaga
atctcaaagaaagatgaacagaaggttaggaagaaactcactagcaattacataatcata
gaaactcgtaaggatggtgtgaagttcacaagctccaagcttaaaaagttaggcgaccaa
taccaggcactgcttggtgagtacacaagttgtcagaaaaaggttgttgatgatgtagta
agagtttcagcctccttctcagaggtatttgaaaactttgctgcgatactatctgagttg
gatgttttacaaagttttgctgatttagcaacaagttccccaattccttatgtaagacca
gaaatcacagcatcggaggaaggagatatcattttagaaggtagcagacatccttgtctg
gaggcccaagatggtgttaactttataccaaatgattgcactttggtgagagaaaaaagt
tggtttcagatcatcactgggccaaacatgggtggaaagtccacttttatacgacaggtt
ggtgtgaatgtcctgatggcacaagttggatcgttcgttccatgtgatcgggcgagcatt
agtgtgagagattgtatttttgctcgtgttggtgctggtgattgccagctacgtggtgtt
tcaacctttatgcaagaaatgcttgaaacagcatccatcttgaaaggtgcatcggacaag
tctcttattattattgatgagttggggcgtggaacttccacatatgatggatttggtctt
gcatgggctatctgtgagcatcttgtggaagtgactagagcacctacgttgtttgccacg
cattttcatgaattaactgcattaggacacaaaagtggtgatgagcaccaacacgttcca
aatttgggaattgcaaattaccatgtgggtgcacatatagacccatcaagtcggaagtta
actatgctttataaggttgaacccggtgcatgtgaccaaagctttggtatccacgttgca
gaattcgctaattttccagaagctgttgttgctcttgcaaaaagcaaagcagaagaatta
gaagatttttcaactgcgcccaatttttccgatgattcaaaagatgaggttggatcaaaa
cgcaagagggtatttagcccagacgatgtgactagaggagctgctcgcgctcgccttttg
ttggaggaattggcctcattgcctctagacgagatggatggcaccaaggccgcagaaacc
gtcaccaaactgaaatccgacttcgagaaagatgcagctgataatccttggcttcagcag
ttcctttga

DBGET integrated database retrieval system