KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338276
Entry
4338276           CDS       T01015                                 
Name
(RefSeq) peroxisome biogenesis protein 2
  KO
K06664  peroxin-2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4338276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4338276
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    4338276
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_2 zf-RING_5
Other DBs
NCBI-GeneID: 4338276
NCBI-ProteinID: XP_015637758
UniProt: B9FNL9 Q6ATD1
LinkDB
Position
5:complement(11320504..11327131)
AA seq 342 aa
MTDPETLPSPSASTDSSSPPPDAWAAEYRRLLPQWESMRDSSKIAIPISISRVNQFDAAR
LDVEMSAMLKEQLVKVFSLVKPGLLFQYEPELDAFLEFLIWRFSIWVDKPTPGNALMNLR
YRDERAAPITGKEVRTGLEGPGLSVSQKVLYCISTVGGQYIWSRLQSFSAFRRWGDSEQR
PLARRAWGLVQHAEGLYRASSFFNLLLFLYGARYKTIVERILKARLVYESPNMNRAVSFE
YMNRQLVWNEFSEMLLLLLPLLNSSSVKKFLLPFSKDKSASSSGDEADCPICRSSPSIPF
EALPCQHRYCYYCLQTRCAATNSYRCARCNEIVVAIQRQGSS
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgacggatcccgaaaccctaccctctccctccgcctccactgactcgtcgtcgccacca
ccggatgcatgggccgccgagtaccggagactcctccctcagtgggagtcaatgcgtgat
tcatccaagatcgctatcccaatttcaatatctagagttaaccaatttgatgctgcgagg
cttgatgtcgagatgtccgccatgttgaaagagcagttagtcaaagtattctctttggtg
aagccaggactcctgttccaatatgagccagaattagatgctttccttgagttcctcata
tggagattctcaatatgggttgataagccaactcctgggaatgcgctcatgaacctgaga
tatagagatgaacgggcagcgcccataacaggaaaagaagtcagaacaggtttggaagga
cctggactttcagtttctcaaaaggttttgtattgtattagcactgttggtggccaatat
atatggtcccgcttgcagtctttttctgctttccgtcgatggggtgattctgaacagaga
ccactagcacgtcgcgcttggggcttggtgcagcatgctgaaggcttatacagagcttct
tcattctttaaccttttgttatttctttatggtgcaagatataaaactattgttgaaagg
attctgaaagcaagacttgtttatgagagccccaacatgaatagggcagtaagctttgag
tacatgaaccggcaactggtttggaatgaattttcggaaatgttgcttttgcttcttccc
ctcttaaactcatcctcagtaaagaagtttcttctacctttctccaaagataaatcagca
agttcttctggcgatgaagcagactgccctatatgtcgctccagtcctagcattcccttc
gaagctctcccatgtcaacacaggtattgctattactgcctgcaaacacgttgtgcagcc
acaaactcgtatagatgtgcaaggtgtaatgagattgttgttgcaattcaaagacaagga
tcaagttag

DBGET integrated database retrieval system