KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338487
Entry
4338487           CDS       T01015                                 
Name
(RefSeq) cytosolic endo-beta-N-acetylglucosaminidase 1 isoform X1
  KO
K01227  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase [EC:3.2.1.96]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4338487
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.96  mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
     4338487
SSDB
Motif
Pfam: Glyco_hydro_85 Glyco_hydro_18
Other DBs
NCBI-GeneID: 4338487
NCBI-ProteinID: XP_015640506
LinkDB
Position
5:complement(16312800..16319420)
AA seq 720 aa
MPFSPRRLLRRLRSMLPSAAPAAAAGEEEEEGERRPWEPPFDASQPAPPISYPITTLAAL
ASRAYLSEAGNFHLPFNRASSSPRAAPLPPRRRILACHDFRGGYRDDAAPQGGHDPGAYA
LWHWHLIDVFVYFSHYLVTLPPPCWVNAAHLHGVKVLGTFITEWEKGAEICEEMLATEAS
AQMYAERLTELAAYLGFDGWLINIEVKLDIQFIDNLKEFINHLTKTMHAAVPGSLVIWYD
AITIKGALDWQNKLNEYNKPFFDLCDGLFSNYTWKAKYPQESAVVAGERKYDVYMGIDVY
GRNTFGGGQWNVCERISKFCLTNVALDLLKKDDVSAAIFAPGWVYETKQPPNFRTAQNRW
WGLVQESWGVLQSYPKQLPFYSDFDQGHGYQVSIEGVKVYGAPWDNISCQSFQPMLKYAG
DRGLQTVINFEDEPYSGGNCVTVKGSLQQNEIFSEQLFNGGLSMEGESVYVFYSVKADER
SGLGLSLDLSSGNNESSSILIADDTAAFTRKKQHRKYGSYVKADKAEPHTPVHQNWVVYK
ATILPSAGFTLTGINIVCTMKTTSGTDPETDGDGSSEAGANRSLHYHASLGHVSIRNTEE
TEFPPARSWVTEGDYISWSNGSDESKLASLKISWELENKQQAPFMKYNVYVEKLTADSNA
KAPRIFLGVASVQVFYVSDLEVPSEVTALKFFIQPCGRDGSCQGLHECPKFHLVPVDSAM
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgccattctcgccgcgccgcctcctccgccgcctccgcagcatgctcccctccgccgcc
cccgccgccgccgccggagaagaagaagaagaaggcgagcggcggccgtgggagccgccc
ttcgacgcgtcccagccggcgccgcccatctcctaccccatcaccacgctcgcggcgctc
gcctcccgcgcctacctctccgaggccggcaacttccacctccccttcaaccgcgcctcc
tcctcgccccgggccgcgccgctcccgccccggcgccgcatcctcgcgtgccacgacttc
cggggcgggtaccgcgacgacgcggcgccgcaggggggccacgacccgggcgcctacgcg
ctctggcactggcacctcatcgacgttttcgtctacttctcacactacctcgtcacgctc
ccgccgccgtgctgggtcaacgccgcccacctccacggcgtcaaggttttggggacgttc
atcacagagtgggagaaaggtgcagagatctgcgaggagatgcttgctacggaggcttct
gcccaaatgtatgctgaaaggctaacagagctggctgcttacttgggctttgatggctgg
ctgatcaatattgaggttaaactcgacatacaattcattgataacctgaaagaatttatc
aatcatctaaccaagacaatgcatgctgctgttcctggatcattagtcatatggtatgat
gcaattactataaaaggtgcccttgactggcagaataagcttaacgagtataacaagcca
ttctttgacttgtgtgatggactgtttagcaattatacttggaaggcaaaatatccacaa
gaatcagctgtagttgctggtgaaaggaagtacgacgtgtacatgggtattgatgtttac
ggacgaaacactttcggtggtggtcagtggaatgtatgtgaaaggatctccaaattttgt
ctcaccaatgttgcccttgatctactcaagaaagatgatgtctcagctgccatatttgca
cctggatgggtatatgaaactaagcaaccacctaactttcggactgcacaaaatcgttgg
tggggtcttgttcaagaatcatggggtgttcttcagagttatccaaaacagttgcctttt
tactctgattttgatcagggtcatggttaccaggtatcaattgaaggggtcaaagtttat
ggtgctccatgggacaatatttcttgccaaagtttccagcctatgctgaaatatgctgga
gatcgaggtctgcaaactgttatcaatttcgaggatgaaccatacagtggagggaattgt
gttacagtgaagggaagtctccagcagaatgaaattttctcagaacagctttttaatggg
ggcctttccatggagggggaatctgtatatgtgttttattcagtaaaagccgatgaacgc
tctggtttagggttgtcactggatttgtcatccggaaacaatgagagcagttccattctt
attgctgatgacacagcagcattcacaagaaagaaacaacaccgaaaatatggctcatat
gttaaagctgataaggcagaaccacacactccagttcaccaaaattgggttgtctacaaa
gcaactatcctgcccagtgctggctttacattaactgggatcaacatagtctgcacaatg
aaaaccactagcggaactgatccagaaacagatggagatggaagctcagaagcaggtgca
aacagatcattgcattaccatgcatcgcttggccatgttagcattcgaaacactgaagaa
acagagttccctccagcaagatcatgggtgacggaaggcgattacatctcctggtcgaat
ggttcagatgaatctaaacttgcaagcctgaaaatcagttgggaacttgaaaataaacag
caggcaccattcatgaagtacaatgtctatgttgagaagttaactgcagactcaaatgca
aaggctcccagaattttccttggagttgccagcgtacaagtcttctatgtatctgaccta
gaggtccccagcgaagtcactgctctgaaatttttcattcaaccgtgtgggcgtgatggg
agttgccaaggactgcacgaatgcccaaagttccatttggttcctgttgattctgccatg
taa

DBGET integrated database retrieval system