KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338495
Entry
4338495           CDS       T01015                                 
Name
(RefSeq) probable AMP deaminase
  KO
K01490  AMP deaminase [EC:3.5.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4338495
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     4338495
SSDB
Motif
Pfam: AMP_deaminase A_deaminase Dscam_C
Other DBs
NCBI-GeneID: 4338495
NCBI-ProteinID: XP_015640001
LinkDB
Position
5:complement(16477623..16488666)
AA seq 875 aa
MGSDASDPSYRLHLACAALVGASVAAASGYYLHCRSVAAQLGDGLSRSASAQRRGGGGRA
PPRAAGKSPAPPPPPPRRAPAGSSSLPDLSSLYSVGLGVGGAGAARRYPVAEEEEEEDDD
DDGMKELADAAEACLPVPLGLPRLHVGPDGNKQLVRSSSNRRVGIIKPNSPKSPVASASA
FESVEGSDEDDAKQPNGKLENGYLKMNGNVEGEQKGNKVLENGAAAPLAAASLIRSHSIS
NDLHGVQPDPVAADILRKEPEQESFIKLLTAPHEIPSPDEIEVYKLLQKCLELRDCYLFR
EEVAPWEKEVINDPCTPKPDPNPFTYVPEPKSEHVFQMVDGVVHVYADKDYTEILYPVAD
ATTFFTDLHYMLRVISAGNTRTVCHNRLNLLEHKFKFHLMLNADREFLAQKTAPHRDFYN
VRKVDTHVHHSACMNQKHLLRFIKSKLRKEPDEVVIFRDGTYMTLKEVFESLDLTGYDLN
VDLLDVHADKSTFHRFDKFNLKYNPCGQSRLREIFLKQDNLIQGRFLAELTKQVFSDLTA
SKYQMAEYRISIYGRKQSEWDNLASWIVNNELSSENVVWLVQIPRLYNVYKEMGIVTSFQ
TLLDNIFLPLFEVTIDPASHPQLHVFLKQVVGLDLVDDESKPERRPTKHMPTPEQWTNVF
NPAFSYYAYYCYANLYTLNKLRESKGMTTIKFRPHAGEAGDIDHLAATFLLCHNISHGIN
LRKSPVLQYLYYLGQIGLAMSPLSNNSLFLDYHRNPFPMFFQRGLNVSLSTDDPLQIHLT
KEPLVEEYSIAASLWKLSSCDLCEIARNSVYQSGFSHALKAHWIGKNYYKRGPTGNDIHK
TNVPHIRVQFRDLIWRDEMRLVYLNNVILPDEVDQ
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgggctccgacgcctccgacccctcctaccgcctccacctcgcctgcgccgcgctggtg
ggcgcctccgtcgccgccgcctccggctactacctgcactgccgctccgtcgccgcccag
ctcggcgacggcctctcccgctccgcctccgcccagcgccggggcgggggcggccgagcc
ccaccgcgcgccgccgggaagtccccggcgccgccgccgcccccgccccgccgcgcgccc
gcgggatcgtcctcgctccccgacctctcctcgctctactccgtcggcctcggcgtcgga
ggggcgggcgccgccaggaggtaccccgtggccgaggaggaggaggaggaggacgacgac
gacgacggcatgaaggagctcgccgacgccgccgaggcgtgcctcccggttcccctcggc
ctccccaggctgcacgtggggcccgacggcaataaacagcttgtccgttcaagttcaaac
agaagggttggaataatcaaaccaaattcacccaagtcccctgttgccagtgcaagtgct
tttgagagtgtagaaggatcagatgaggatgatgctaaacaaccgaatggtaaacttgaa
aatggctacctgaagatgaatggaaatgttgaaggagaacagaaaggaaacaaagtactg
gaaaatggggctgcagcgccattagctgcagcaagtttgattcggtctcatagtatatcc
aatgatcttcatggtgttcaacctgatccagttgctgcagacattcttcgaaaagaacct
gagcaagaatcatttattaagctgttaactgctccacatgagattccgtctcctgatgag
attgaggtttacaagctccttcagaagtgccttgagttaagagactgttatctttttaga
gaagaggttgctccatgggagaaggaggtcataaatgatccctgtactccaaaacctgac
cccaatccgttcacctatgtgcctgaaccaaaatcagagcatgttttccaaatggtcgat
ggtgttgtccatgtctatgcagataaagactatacggaaatactttatcctgttgctgat
gcgacaaccttctttactgacttgcattatatgctccgtgtgatttctgctggaaacaca
agaaccgtgtgccataaccggttaaatcttttagagcataaattcaaatttcatttgatg
ttaaacgcggatagggagtttcttgcccagaagactgcaccacatcgtgatttttacaat
gtcaggaaggttgatactcatgtacaccactcagcgtgcatgaatcaaaaacacttgctg
agatttataaaatccaaactaaggaaagaacctgatgaggttgtcattttcagagacggc
acttatatgactctgaaggaggtttttgagagcttggacttaactgggtatgacttgaat
gttgatttactagatgtccatgcggacaaaagtacatttcatcgttttgacaaattcaac
cttaagtacaatccgtgtggccaaagtaggctcagagagattttcctcaaacaggacaat
cttatccaaggtcgttttcttgccgagctaacaaagcaagttttctccgaccttacagca
agtaaataccagatggctgaatataggatttcaatctatgggaggaagcaaagtgaatgg
gacaaccttgcaagctggatagtgaacaatgaattgtccagtgaaaatgttgtctggctg
gttcagatcccacgcttatataatgtgtacaaggaaatgggtattgttacatcattccaa
actcttctggacaacattttccttcctctgtttgaggtcaccattgatccagcttctcat
ccgcagcttcacgtcttcctaaagcaggttgtagggttagatttggttgatgatgagagt
aaacctgaaaggcgtccaacaaagcatatgcctacacctgaacaatggaccaatgtcttc
aacccagcattttcatattatgcatattactgctatgctaacttatacacactcaataag
ttgcgtgaatcaaaagggatgaccacaatcaaattccgtccacatgctggcgaggctgga
gacatcgatcacttggcagcaacatttcttctttgtcacaatatatcgcatggaatcaac
ttaaggaaatctcctgtgcttcaatatctatactatcttggccagattggtctggcaatg
tccccattaagcaacaactccttgtttcttgattaccaccggaatcctttcccaatgttt
ttccaacgaggcctgaatgtttccctgtcaacggatgatccattgcaaattcacctgaca
aaagagccattggtggaagaatacagcattgctgcttcactctggaagctcagttcttgt
gatttatgtgaaatagctagaaactctgtctatcaatcagggttttcacatgctctcaag
gcacactggattggcaagaactattacaaaagaggacctacagggaacgatattcataaa
actaatgtgcctcacatcagggttcagtttagggacttgatttggagagatgagatgcgt
cttgtatacctaaacaatgtcatcttacctgacgaggtggaccagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344386
Entry
4344386           CDS       T01015                                 
Name
(RefSeq) probable AMP deaminase
  KO
K01490  AMP deaminase [EC:3.5.4.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4344386
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     4344386
SSDB
Motif
Pfam: AMP_deaminase A_deaminase
Other DBs
NCBI-GeneID: 4344386
NCBI-ProteinID: XP_015646516
UniProt: Q84NP7
LinkDB
Position
7:29505386..29512077
AA seq 815 aa
MDSTYALHLAVATLLGASFAAASAYYMHRKTLDQLLRFARSLDRDHRRRNRHLLDADDDD
DDDPPRDHDRRTTLPIPPGLPPLHTGREGKPIISPASTKRVGPLVRPTTPRSPVPTVSAF
ETIEDSDDDDENIAPDAKNNAVSLLTNGTIGSDPLPGKASQNGDTKPVPSTNMIRSQSAT
GSLHGAQHNPVAADILRKEPEHETFSRINITAVETPSPDEIEAYKVLQKCLELREKYMFR
EEVAPWEKEIITDPSTPKPNPNPFYYEQQTKTEHHFEMVDGVIHVYPNKDAKERIYPVAD
ATTFFTDMHYILRVLAAGDIRTVCYKRLNLLEQKFNLHLMVNADRELLAQKAAPHRDFYN
VRKVDTHVHHSACMNQKHLLRFIKSKLRKEPDEVVIFRDGTYLTLKEVFESLDLTGYDLN
VDLLDVHADKSTFHRFDKFNLKYNPCGQSRLREIFLKQDNLIQGRFLAELTKEVFSDLEA
SKYQMAEYRISIYGRKKSEWDQMASWIVNNELYSENVVWLIQIPRIYNVYREMGTINSFQ
NLLDNIFLPLFEVTVDPASHPQLHVFLQQVVGLDLVDDESKPERRPTKHMPTPEQWTNVF
NPAYAYYVYYCYANLYTLNKLRESKGMTTIKLRPHCGEAGDIDHLAAAFLTSHNIAHGVN
LKKSPVLQYLYYLAQIGLAMSPLSNNSLFIDYHRNPFPTFFLRGLNVSLSTDDPLQIHLT
KEPLVEEYSIAASLWKLSSCDLCEIARNSVYQSGFSHRLKSHWIGRNYYKRGHDGNDIHQ
TNVPHIRIEFRHTIWKEEMELIHLRNVDIPEEIDR
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggactccacctacgccctccacctcgccgtcgccaccctcctcggcgcctccttcgcc
gccgcctccgcctactatatgcaccgcaagaccctcgaccagctcctccgcttcgcccgc
tcccttgaccgcgaccaccgccgccgcaaccgccacctcctcgacgccgacgacgacgat
gacgacgaccctcccagagaccacgatcgccgcaccacccttcccatcccaccgggcctt
ccgccacttcacaccggccgagaaggaaagccaattatctcaccagcttccaccaaaaga
gttggacctttggttagacctactacaccaagatcccctgttcctactgtcagtgcattt
gaaactattgaagattcagatgacgatgatgagaatattgccccagatgccaaaaacaat
gccgtttccttgctcacaaatggaactattggatcagatccccttccgggtaaagcaagt
cagaatggggacacaaaaccagtaccatcaacaaacatgattagatctcaaagtgcaaca
ggcagtctgcatggggcccagcacaatccagttgcagctgatattcttcgaaaggaacct
gaacatgagactttcagtaggatcaatataacagctgttgagactccatctcctgatgaa
attgaagcatacaaggttcttcagaaatgtcttgagctacgagagaagtacatgtttaga
gaagaagttgctccatgggagaaggaaatcataactgatcctagtactccaaaacctaat
cctaaccctttctattacgagcagcagactaaaactgaacatcattttgaaatggttgat
ggtgttattcatgtataccccaataaagacgctaaagaaagaatctatcctgttgctgat
gctactaccttttttactgatatgcactatatccttcgtgtgttggctgctggggatatt
cgaactgtatgttataaacgtttaaatcttctagaacagaaattcaatcttcatttgatg
gtcaatgccgatagagaactacttgctcagaaagctgcaccccatcgggacttctacaat
gtcaggaaggttgatactcatgttcatcactctgcatgcatgaatcagaagcatctgttg
agatttatcaagtccaagttgaggaaagaacctgacgaggttgtgatttttagagatggt
acctatttgactcttaaggaggtttttgagagtttggacttgactggttatgacctcaat
gttgatctcttagatgtgcatgccgataaaagtacattccatcgctttgacaagttcaat
ttgaagtataatccttgtggccaatcccggctgagggagatctttcttaaacaggacaac
cttattcaaggccgatttcttgctgaattgacaaaagaagtattttctgatcttgaagca
agtaaatatcagatggctgagtatagaatatctatctatgggagaaagaaaagtgagtgg
gatcagatggcaagctggatagtgaataatgaattgtacagcgagaatgttgtttggtta
attcagattcctcggatatacaatgtatacagggagatgggaacaatcaattctttccag
aacctccttgacaatatttttctgcctctttttgaagtaactgttgatcctgcttcacat
cctcagctccatgttttcttgcaacaggtcgttgggctggatttagtggatgatgaaagc
aaaccagagagacgcccaacaaaacacatgcctacacctgagcaatggactaatgttttc
aatccagcatatgcatattatgtgtactattgttatgctaacttgtacacgctgaacaag
cttcgtgagtccaagggtatgacaacaatcaaacttcgtccacactgtggggaggctgga
gatattgatcatcttgctgcagcatttcttacttctcataatattgctcacggggttaat
ttaaagaagtcccctgtcctccagtatctgtattacctagctcagattggtcttgccatg
tctcctttgagcaacaactcattgtttattgattatcaccgaaaccctttcccaacattt
ttcctaagaggccttaacgtttctctatcaaccgatgaccctttgcaaattcacctgaca
aaagaacctttggttgaagaatatagcatcgctgcttcgctgtggaagctaagttcatgc
gacctatgtgaaattgctaggaattctgtgtaccagtctggtttctctcataggctcaag
tcacactggattgggagaaactactacaaaagaggtcatgatggcaatgacattcaccag
acaaatgttcctcacatcaggattgaattccgacacactatttggaaagaagaaatggag
ctaatacatctgaggaatgttgatataccggaagaaattgataggtga

DBGET integrated database retrieval system