KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338660
Entry
4338660           CDS       T01015                                 
Name
(RefSeq) UDP-sulfoquinovose synthase, chloroplastic
  KO
K06118  UDP-sulfoquinovose synthase [EC:3.13.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4338660
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4338660
Enzymes [BR:osa01000]
 3. Hydrolases
  3.13  Acting on carbon-sulfur bonds
   3.13.1  Acting on carbon-sulfur bonds (only sub-subclass identified to date)
    3.13.1.1  UDP-sulfoquinovose synthase
     4338660
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd Pyr_redox_2 Polysacc_synt_2 UDPG_MGDP_dh_N NAD_binding_8 DAO DAGK_cat
Other DBs
NCBI-GeneID: 4338660
NCBI-ProteinID: XP_015639746
UniProt: A0A0P0WM00 Q60E66
LinkDB
Position
5:18738600..18741790
AA seq 479 aa
MKMAHMVTNCSFSPSPAVKTYSKSPGYCCNVTQFQSSKCSNLVLKSCTATRPNRPFVARA
SAAVQGQTQTPLTGSQQASGHSSSKPKKVMVIGGDGYCGWATALHLSNKGYEVAIVDNLV
RRLFDHQLGLDSLTPIASIQNRIRRWKALTGKTIQLYVGDICDFDFLSEAFKSFEPDSAV
HFGEQRSAPYSMIDRSRAVFTQHNNVIGTLNVLFAIKEFSEECHLVKLGTMGEYGTPNID
IEEGFITITHNGRTDTLPYPKQASSFYHLSKVHDSHNIAFTCKAWGIRATDLNQGVVYGV
RTDETAMHEELSNRFDYDGVFGTALNRFCVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCV
ELAIANPAKPGEFRVFNQFTEQFSVNELAKLVTAAGAKLGLEVQTKSVPNPRVEAEEHYY
NAKHTKLMELGLEPHLLSDSLLDSLLNFAVQYKDRVDTAQIMPSVSWKKMGAKPKTVSV
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaaaatggcacatatggtaactaactgtagtttcagcccttcgcctgcagttaagacg
tactcgaaatctcctggttattgctgcaatgtgacccaattccagagctcaaaatgttcc
aatctagtgctcaaatcatgtactgcgacaagaccgaacaggccatttgtcgctcgtgct
agcgctgctgtacaaggacagacacaaacaccccttactggaagtcagcaagcatctggg
cactcatcctctaaacccaaaaaggtcatggttatcggcggagatggctactgcggctgg
gcaaccgcacttcatctctccaataaaggatacgaggttgccattgttgacaatcttgtg
cggcgcctttttgatcaccaacttggcctggattccctcacacccatagcctccatccag
aatcgcatccgtcggtggaaggctctaaccggaaagacgattcagctctatgttggtgat
atatgtgactttgatttcctttcagaagccttcaagtctttcgagccggattctgctgtc
cactttggtgagcagagatcagcgccatattctatgattgatcgttcccgtgcggtattc
actcagcataacaatgttatcggaactcttaatgtattatttgccattaaggagttcagt
gaagaatgccatctggtcaaactaggaaccatgggtgagtatggaactccaaatattgac
attgaagaagggttcatcactattacccacaatggaagaactgataccttgccttaccca
aagcaagcgagctccttctaccatctaagcaaagtgcatgactcgcacaatatagcattt
acatgcaaggcttggggtataagggccacggatcttaaccaaggtgttgtatatggagtg
agaacagatgaaactgcaatgcatgaagaactatccaacaggtttgattatgatggcgtc
tttgggacagcactgaataggttctgtgttcaggctgctgtaggtcatccacttacagtt
tatggaaaaggtggtcagacccgtggatatctggacatcagggatacagtgcaatgcgta
gagctcgcaatcgccaacccagccaaaccaggtgagttcagggtcttcaaccagttcacc
gagcagttctcggtcaacgagctggcaaagctggttacggccgccggtgcaaagcttggg
ctggaggtgcagaccaagtcggtgcccaacccgcgggtggaagcggaggaacactactac
aacgccaagcacaccaagctcatggagctcggcctggagccccacctgctgtcggactcg
ctcctcgactcgctgctcaacttcgccgtccagtacaaggacagggtcgacacggcgcag
atcatgcccagcgtgtcgtggaagaagatgggggcgaagccgaagacggtgtccgtctaa

DBGET integrated database retrieval system