KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338667
Entry
4338667           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L1, chloroplastic
  KO
K02863  large subunit ribosomal protein L1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338667
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338667
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4338667
  Bacteria
    4338667
  Archaea
    4338667
SSDB
Motif
Pfam: Ribosomal_L1
Other DBs
NCBI-GeneID: 4338667
NCBI-ProteinID: XP_015640664
UniProt: B9FPD8 Q60E59
LinkDB
Position
5:18789641..18793663
AA seq 359 aa
MATAASLSATASSLLAPAPATTGAAAAQCCSSSSTALFPTPVPSLRAYYPRLLLAFRRPA
VAAVADPQGAVLEEEQGEQQDEGQEQYDDDDYDDGYEGGRGPAFTPPTRPRTGKAALPLK
RDRTRSKRFLEIQKLRESKKEHDVPTAISLVKQMASARFVESAEAHFRMNLDPKYNDQQL
RATVNLPKGTGQSVKIAVLTQGEKIDQARAAGADIVGGDDLIDQIKGGFMEFDKLIASPD
MMPKVAGLGKILGPRGLMPNPKAGTVSPNITQAIEEFKKGKVEYRVDKTGIVHIPFGKVD
FPEEDLIANFMAVVRSVERNKPSGAKGIYWKTAYLCSSMGPSIKLNIKEMLDYGSESSD
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggccacagccgcttccctctccgccaccgcctcctccctcctcgcccccgcccccgcc
accaccggcgccgcggcggcgcagtgctgctcctcctcgtccaccgcgctgttccccacc
cccgtcccgtcgctgcgcgcctactacccgcgcctgctcctcgcgttccgccgccccgcc
gtcgccgccgtcgcagacccgcagggcgccgtgctcgaggaggagcagggggagcagcag
gacgaggggcaggagcagtacgacgacgacgactacgacgacgggtacgagggcggacgc
ggccccgcgttcacgccccccacccgcccgcgcaccggcaaggccgcccttccgctcaag
cgcgaccgcacgaggtcgaagcgattcctggagatacagaagctgagggagagcaagaag
gagcacgacgtgcccacggccatctcgctggtgaagcagatggccagcgcccgattcgtc
gagtccgctgaggcgcacttccgcatgaacctcgaccccaagtacaacgaccagcagctc
cgcgccacggttaatttgcccaaggggacgggccagtcggtgaagattgcggtcctcaca
caaggtgagaagatagatcaagcaagagctgcaggagctgatattgtcggtggagatgac
ctgattgaccaaataaaaggaggatttatggaatttgacaagctgattgcatcacctgat
atgatgcctaaggtcgccggattgggaaagattctaggaccgagaggacttatgcctaac
cccaaagctgggactgtttctccaaacataactcaggctatcgaagagttcaagaaaggt
aaagttgaatacagagttgacaagacagggattgttcacattccctttgggaaggttgat
tttcctgaagaagaccttattgcaaacttcatggctgttgttcgctctgtcgaaaggaac
aaaccatctggtgcaaaggggatatactggaaaacggcatacttatgctcatcaatgggg
ccttcaatcaagttaaacatcaaagaaatgcttgactatggctcagaatcatcagactaa

DBGET integrated database retrieval system