KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338689
Entry
4338689           CDS       T01015                                 
Name
(RefSeq) cyclin-dependent kinase D-1
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4338689
  09124 Replication and repair
   03420 Nucleotide excision repair
    4338689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4338689
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4338689
   03019 Messenger RNA biogenesis [BR:osa03019]
    4338689
   03400 DNA repair and recombination proteins [BR:osa03400]
    4338689
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     4338689
    2.7.11.23  [RNA-polymerase]-subunit kinase
     4338689
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   4338689
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4338689
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     4338689
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4338689
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 RIO1 Seadorna_VP7
Other DBs
NCBI-GeneID: 4338689
NCBI-ProteinID: XP_015640677
UniProt: P29620 B9FPF8
LinkDB
Position
5:19083891..19089921
AA seq 424 aa
MASGDGGDDAGVKRVADRYLKREVLGEGTYGVVFKAVDTKTGNTVAIKKIRLGKYKEGVN
FTALREIKLLKELKDSNIIELIDAFPYKGNLHLVFEFMETDLEAVIRDRNIVLSPADTKS
YIQMMLKGLAFCHKKWVLHRDMKPNNLLIGADGQLKLADFGLARIFGSPERNFTHQVFAR
WYRAPELLFGTKQYGSAVDIWAAGCIFAELLLRRPFLQGSSDIDQLGKIFAAFGTPKSSQ
WPDMVYLPDYVEYQFVSAPPLRSLFPMASDDALDLLSRMFTYDPKARITAQQALEHRYFL
SVPAPTKPSQLPRPPPKGDSGNNKIPDLNLQDGPVVLSPPRKLRRVTAHEGMEVHMHRAD
RTEEHPSGARHMDDMSSQSSRIPMSVDVGAIFGTRPAPRPTLNSADKSRLKRKLDMDPEF
GYTE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcgagcggcgacggcggcgacgacgcgggcgtgaagcgcgtggcggaccgctacctg
aagcgcgaggtcctgggagagggaacctacggcgtcgtcttcaaggccgtcgacaccaag
actgggaatacagtcgcaataaagaaaatccggctagggaagtacaaggaaggtgtcaat
ttcactgcattgagggaaattaaacttcttaaggagctgaaagattctaatattatagag
ctgattgatgctttcccttacaagggaaacttacatcttgtatttgagttcatggagact
gatttggaagctgtcatacgagataggaacattgtattatctccagctgatacaaaatct
tatattcagatgatgttaaaaggtttagccttctgccataagaaatgggtgctacacagg
gatatgaaaccaaataatttactcattggcgctgatgggcagcttaagcttgctgacttt
ggtctggcgcgcatatttgggagtccagagcggaacttcactcatcaggtctttgcacga
tggtaccgagcaccagaattattatttggcaccaagcagtatggatctgcagttgatatt
tgggctgctggttgtatttttgctgaactgctgcttaggcgaccgtttctccagggttct
agtgacattgatcaacttgggaagatctttgctgcatttggaactccaaagtcttctcaa
tggccggacatggtttatcttccagattatgttgaataccaatttgtctctgcacctcca
cttcgctcattgtttccaatggccagtgatgatgcattggatcttctatcaagaatgttt
acatatgatccaaaagcaagaattacagctcagcaggctctagaacaccggtacttttta
tcagtaccagcgccaacaaaaccatcacagcttccaaggccaccacctaagggtgattca
gggaataacaagataccagacttgaacctgcaggacggccctgttgttctgtccccgcca
agaaagttgcgcagggtgactgcccatgaagggatggaagtccatatgcatcgggcggat
agaacagaagagcatccttcaggggcaaggcacatggatgacatgtccagccagagttct
agaataccaatgtcagttgatgttggagctatttttgggacacgacctgctcctagacca
acgttaaacagtgccgacaagtctcgtttaaaacggaaacttgatatggatccagaattt
ggatacacagagtaa

DBGET integrated database retrieval system