KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338726
Entry
4338726           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerase II subunit RPB7
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4338726
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4338726
   03019 Messenger RNA biogenesis [BR:osa03019]
    4338726
   03400 DNA repair and recombination proteins [BR:osa03400]
    4338726
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     4338726
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4338726
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4338726
SSDB
Motif
Pfam: S1 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 4338726
NCBI-ProteinID: XP_015639700
UniProt: A0A0P0WLZ8 Q6ATY6
LinkDB
Position
5:complement(19488425..19490604)
AA seq 177 aa
MFFHIVLERNMQLHPRHFGPHLRDKLVSKLIKDVEGTCSGRHGFVVAITGVEDVGKGLIR
EGTGYVTFPVKYQCVVFRPFKGEILEAVVTMVNKMGFFAEAGPVQIFVSNHLIPDDMEFQ
SGDVPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVISDPGAAV
NT seq 534 nt   +upstreamnt  +downstreamnt
atgttcttccacatcgtgctggagcggaacatgcagctgcacccgcggcacttcggcccg
cacctccgcgacaagctcgtctccaagctcatcaaggacgtcgagggcacctgcagcggg
cggcatgggttcgtggtggcgatcacgggggtggaggatgtcggcaaggggctcatcagg
gagggcacgggctacgtcaccttcccggtcaagtaccagtgcgtcgtcttccgccccttc
aagggcgagatcctggaggccgtcgtcaccatggtcaacaagatggggttcttcgcggag
gctgggcctgtgcagatcttcgtgtccaaccatttgattcctgatgatatggagttccaa
tctggggatgtgccaaattatactacttctgatggatcggtgaaaattcagaaagatagt
gaggttcggttgaagattattgggacacgtgttgatgcaacagaaattttttgcattggc
acaataaaagatgacttcctgggcgttatcagtgatcctggtgcggcagtgtaa

DBGET integrated database retrieval system